CAZyme Information: ACLA_060920-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_060920-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: glycosyl transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
739	DS027050|CGC6	82594.51	8.1133

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027050:148402-150777(-)

Full Sequence      

MSEYPGQDGHEEKIGLRVHHRPCHHNQSSFDSLDQAAPGALTPARPGEIPLEDYGSPGWY
QSTARSSFANTPLDSRSASPSLYQNNQIQQSHQSLAPLVTTAASPVFVKDWVQSGSIARL
HDRDDVEIWKGWKRWVFRFVPLLTLANTGLYLFYLGLRIACIILAQRAAGFTYAGAWVFV
AIEIAVAIPSLMHNCWTMMALKKRGRPKLRLTGNEAPTVDVFVTCCGEQDEVVLDTVRGA
CDQDYPSDRFRVIVLDDGQSATLEAAVHQLSMTHPNLMYMAREKIPGKPHHFKAGNLNYG
LERTNSLPGGAGQFMAALDADMIPEQDWLRAILPHLLVDPKMALACPPQLFYNTPASDPL
AQSLDFFVHVIEPIKDALGVAWCTGSGYVVRREALEDIGNFPLGSLAEDVATSTLMLGKG
WKTAYIHEPLQFGTVPEDFGGHLKQRTRWAIGTVDTAVKLKFCLWGDGVRQMSMAQRFSG
FLYATLSLYTLLLTASLFAIPIILLWGKQLVAYATEEQLRWLIWACFAANVSNRLCEFAL
FIPAGYHTGQRGSRYQLWMAPYIALCIVRSFMLPRWLGGQAQAFKPTGSLGSALEERDPK
RRKNMFVRLRVILLNYMAFFHLAFVYVTLIAVVISSYRCFAKESSFRGIILCLITHAFWP
PLTFLFICTSLWTPVAYAVDPPVMPDREDLLTRDSKTGVAHPTQKSKKIAFGGQAAWFEF
QYAVATAATILIFVYSFFF

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	218	451	2.3e-22	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.71e-103	217	457	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	5.47e-38	175	506	12	334	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	3.09e-26	217	454	260	489	cellulose synthase catalytic subunit; Provisional
133045	CESA_like	7.10e-26	221	409	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133057	CESA_NdvC_like	5.99e-24	223	454	4	229	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
XP_748682.1|GT2|2.4.1.-	0.0	1	739	1	727
EAL86644.1|GT2|2.4.1.-	0.0	1	739	1	727
CAP86064.1|GT2	0.0	1	739	1	753
QQK47888.1|GT2	0.0	69	739	15	685
QKX54251.1|GT2	0.0	11	739	20	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.67e-26	211	575	122	487	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.96e-26	211	575	134	499	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.97e-26	211	575	135	500	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	7.09e-23	217	470	273	517	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6YV7_B	9.37e-08	206	422	41	235	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19449|BCSA1_KOMXY	6.60e-31	217	598	149	506	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	1.08e-30	182	484	101	407	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	1.08e-30	182	484	101	407	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
sp|O82859|BCSA2_KOMSB	2.06e-30	217	569	149	481	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	1.35e-29	214	569	146	479	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000003

TMHMM  Annotations     

Start	End
135	157
170	192
485	507
520	542
557	579
612	634
649	671
716	738