CAZyme Information: ACLA_060160-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_060160-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: glucose-methanol-choline (gmc) oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	DS026990|CGC5	58082.86	4.7332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS026990:878594-880282(-)

Full Sequence      

MSSTTLPSSADYLIIGGGTAGLVVANRLSEDPNLRVVVLESGPDRTTDAQVQNPATWATL
GGSDLDWKMKIVPQPGLNNRTQEHPAGKVLGGSSAINGLFFVPPSPAGINAWAKLGNPGW
TWESFVPYLQKTYSLVPQGTTEVDLTQKTQQEPARGPIQVTYPALADQDNGRLIQAWNDA
FQAQGYEFTGDFLAQEKSVGTRPYTATIHPQSGLRSAADTAYTSTIADRENLTIVTEATV
QKILFDATSEPVAATGVEVAWNGEVTTIQARKEVILAAGAFHSPKLLELSGIGERNRLSA
LGIPVLVDQPGVGENLQNHPMAVLPLPLKEHPDLEALTPGIQGMAFTRLDTQELETLFAQ
HAKSGTQSEQVLQSILADPNEASAFSILGVMPGNVALLAVIPSFPFSRGSIHVPSPDPDA
MPVIDAGVFTHDVDIEILARHVRQLQQVIATPPLEPYLQSGPPGDVETIKPLLREAMALT
ANHICGTAAMLPREAGGVVDQELKVYGTKNVRVVDASVFPLITHANPMATVYAVAERAAD
LIRK

Enzyme Prediction     

No EC number prediction in ACLA_060160-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	543	5.6e-158	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.50e-107	9	543	5	532	choline dehydrogenase; Validated
225186	BetA	6.63e-100	3	544	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.47e-38	405	538	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.36e-33	2	531	48	565	Protein HOTHEAD
366272	GMC_oxred_N	2.88e-22	78	320	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25452.1|AA3_2	4.10e-204	6	543	5	526
CAK96464.1|AA3_2	5.29e-178	9	543	5	527
BCS12736.1|AA3_2	4.74e-177	1	543	1	529
QRD83786.1|AA3_2	4.85e-173	10	543	4	530
QMW32332.1|AA3_2	4.85e-173	10	543	4	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.17e-77	1	544	1	566	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	2.98e-63	8	544	4	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	5.52e-61	11	542	37	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6XUT_A	1.44e-58	11	543	18	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
4H7U_A	1.73e-57	6	544	35	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	2.54e-81	9	542	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.54e-81	9	542	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.13e-71	11	544	15	610	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.13e-71	11	544	15	610	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.08e-69	8	544	38	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000029

TMHMM  Annotations     

There is no transmembrane helices in ACLA_060160-t26_1-p1.