CAZyme Information: ACLA_056040-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_056040-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: glucose-methanol-choline (gmc) oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		62886.92	5.4632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027048:780774-782605(+)

Full Sequence      

MASEAYWDFVIVGGGPAGCALAATLARSSKRPQVLLLEAGPRNDDPALRVDGQRWATFLA
KGVNWGYSTVPQEHCNNRQIDYSRGKVLGGTSAINFGLYTVGARDDYDEWASVVGDDLYR
WDRMQQRFRNLETFDSAVVDPDHKKYISSRPSDHGSQGALHVGYAAEWERDLPLMMDVFE
KAGFARNPDHNSGNPLGMALLINSFHQGRRVAATDLLEGAPENLTIITESPVQRVILSGK
KAIGVESKGRQFYASKDVILTAGALDSPKILMHSGIGPSEQLGKFQIPLVHDLPAIGQNL
RDHFFAPLSFKRSPETNDRNAFFGDKNAMDEAMTQWMKDGTGPWARYSCQLAAGWFKSDG
LLASAEFQELPPTVQDFLKRETVPHYEFMTNFPVHFIRPQMTDYSYMCLLVFLMNEQSSG
ELRLQSSNPDDPLLFDPKFFSHPFDRRACIEILRDALQVTKHESFTKDTVAPILVPASES
DEDLLAHWKNTLGSSWHMTGTVKMGKSGDVDAAVDSRFRVFGTENLRVADMSVVPVLTNN
HTQATAYVTGLTCAEALIAEYELDCA

Enzyme Prediction     

No EC number prediction in ACLA_056040-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	558	1.4e-149	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.53e-92	1	560	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.00e-82	1	545	1	519	choline dehydrogenase; Validated
274888	Rv0697	3.07e-60	8	557	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
215420	PLN02785	4.85e-39	4	550	54	569	Protein HOTHEAD
398739	GMC_oxred_C	2.43e-37	417	553	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46531.1|AA3_2	0.0	7	564	8	566
BCR99292.1|AA3_2	0.0	7	564	8	566
BCS11595.1|AA3_2	0.0	7	564	8	566
QKD46666.1|AA3_2	2.79e-262	7	563	5	563
UPL00845.1|AA3_2	8.25e-262	1	563	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	7.76e-65	7	560	41	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	5.30e-57	7	560	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	7.21e-57	7	560	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3LJP_A	1.30e-46	3	557	10	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	3.39e-46	3	557	10	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3L245|PDH1_LEUMG	3.99e-64	7	560	41	599	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	2.79e-61	3	560	37	597	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q3L243|PDH2_LEUMG	5.36e-60	7	560	41	597	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1
sp|Q3L1D1|PDH1_AGABI	6.65e-60	7	547	41	579	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|V5NDL4|PDH1_AGACM	2.52e-59	7	547	37	580	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998524	0.001497

TMHMM  Annotations     

There is no transmembrane helices in ACLA_056040-t26_1-p1.