CAZyme Information: ACLA_055320-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_055320-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: cutinase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	DS027048|CGC4	22860.28	8.4712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027048:537473-538228(-)

Full Sequence      

MHFRALLVSALATLAMAAPAPTLEARQSLSSNELENGPCRDVTFIFARGSTEQGNMGFIV
GPPTCTALKLKLGSDKVACQGVGGAYTANLLPNFLSQNTDPKSIAAATDMFQLARTKCPN
TKIVTGGYSQGSAVIDNSVKALDDDLKSRVKAAVLFGFTRNVVDRGQIPNYPKDQVKVYC
AVGDMVCYNTLIITAAHLTYGIYANDAANFLVSKL

Enzyme Prediction     

EC	3.1.1.74:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	38	215	2.9e-42	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.05e-60	38	215	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46952.1|CE5	2.36e-95	4	215	5	221
UDD63915.1|CE5	3.35e-95	4	215	5	221
QRD91206.1|CE5	4.76e-95	4	215	5	221
QMW34880.1|CE5	4.76e-95	4	215	5	221
BAM28634.1|CE5	5.52e-94	4	215	5	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	1.13e-66	23	215	5	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	1.54e-64	32	215	5	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	1.49e-62	32	215	16	198	Chain A, cutinase [Malbranchea cinnamomea]
1CUV_A	4.34e-55	19	215	6	207	Chain A, CUTINASE [Fusarium vanettenii]
1CUW_A	6.15e-55	19	215	6	207	Chain A, CUTINASE [Fusarium vanettenii],1CUW_B Chain B, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C9G0|CUTI3_ASPCL	6.62e-153	1	215	1	215	Probable cutinase 3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_055320 PE=3 SV=1
sp|A1D9W1|CUTI3_NEOFI	5.65e-118	1	215	1	215	Probable cutinase 3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_030250 PE=3 SV=1
sp|Q4W9Z4|CUTI3_ASPFU	4.42e-115	1	215	1	215	Probable cutinase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G03210 PE=3 SV=1
sp|B0YEP5|CUTI3_ASPFC	4.42e-115	1	215	1	215	Probable cutinase 3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_099910 PE=3 SV=1
sp|Q0CNE3|CUTI3_ASPTN	1.46e-104	1	215	1	217	Probable cutinase 3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_04791 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000292	0.999708	CS pos: 26-27. Pr: 0.9494

TMHMM  Annotations     

There is no transmembrane helices in ACLA_055320-t26_1-p1.