CAZyme Information: ACLA_055050-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_055050-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: esterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		28480.05	7.3991

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027048:461476-462294(-)

Full Sequence      

MLPTILYSAILALSALTPSALAETRSSGCGKHPSLANGVIHLNGREYILKLPDRYDNNHA
YHLVFGLHWRGGNMQNVANGESIQPWYGLETRAQGSTIFIAPNGKNAGWANNGGEDVAFI
DAIIKQVEADLCVDQSSRFATGFSWGGGMSYSLACSRAKQFKAVSVLSGGVISGCDGGHD
PIAYLGIHGINDGVLPFNGGVGLAQKFVQNNGCQQANIGAPPSGSKSSVRTDFKGCSKPV
SFIAYDGGHDSAPLGVGSSLAPDATWKFFMAA

Enzyme Prediction     

No EC number prediction in ACLA_055050-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	45	173	7.1e-22	0.5814977973568282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	2.39e-15	44	269	46	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
223489	DLH	6.75e-05	120	196	96	173	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	0.002	43	171	374	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSB17085.1|CBM2|CE0	4.07e-88	26	269	36	285
EGX54170.1|CBM1|CE0	1.49e-87	26	269	94	352
AYC36484.1|CBM2|CE0	2.41e-85	18	269	36	302
AEB46202.1|CBM2|CE0	1.55e-82	18	269	5	279
ATE54694.1|CBM2|CE0	4.61e-82	17	269	32	298

PDB Hits     

ACLA_055050-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C9D4|FAEC1_ASPCL	6.68e-204	1	272	1	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-1 PE=3 SV=1
sp|A1DI08|FAEC_NEOFI	1.92e-178	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=faeC PE=3 SV=1
sp|A4D9B6|FAEC_ASPFU	1.92e-178	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1
sp|B0XU32|FAEC_ASPFC	1.92e-178	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=faeC PE=3 SV=1
sp|A1CC33|FAEC2_ASPCL	3.07e-152	1	272	1	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000320	0.999649	CS pos: 22-23. Pr: 0.9762

TMHMM  Annotations     

There is no transmembrane helices in ACLA_055050-t26_1-p1.