CAZyme Information: ACLA_050370-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_050370-t26_1-p1
• CAZy Family: GH25
• CAZyme Description: DUF409 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	DS027054|CGC3	48894.37	9.6465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027054:1554153-1555685(+)

Full Sequence      

MSSPSRFDVVQSAFSPRHPVKSLSIAFALWKALIFLVVVTCPGPGYDTSTSLLPYQAEGL
SDVISSTHKHRIRSSYLALPLRFVRWDSIYYVHAAEHGYVFEQEWAFGYGYTRIIALLLS
VLVLYKLSIHIFGSHSPKQRFLCLLSAALHIISPAGAFLSAPYGEALFSLLNISGFYLYS
SSVLDGGANKRVSRDLKLLAAATLFFAATTVRSNGIFGGILFAFDAVQQLWKIVCGGLSW
HAIRRLGVIVVGGCVVGLGMIVPQVIAYREYCMVAHVSRPWCEWIIPSIYGWVQEQYWNV
GFLRYWTVPNIPLFLLAMPMLALLLWSSLWGLRLSSVVRKDSNDVAPTMTTATVTSLLTR
LSVVQGVLAVLALTSYHVQIINRISSGYPLWYWYLAAQLVGDATDSSATSKRNRLPAVLM
QTMMIYGLIQAILFGSFLPPA

Enzyme Prediction     

No EC number prediction in ACLA_050370-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	114	441	7.8e-88	0.7272727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.17e-24	84	441	58	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.13e-12	74	441	65	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR82784.1|GT76	1.09e-173	1	441	3	465
BCS01167.1|GT76	2.36e-171	12	441	14	469
BCS12914.1|GT76	2.36e-171	12	441	14	469
CAK38795.1|GT76	4.94e-170	12	441	14	466
BAE58188.1|GT76	3.78e-169	15	441	14	434

PDB Hits     

ACLA_050370-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WQ21|GPI18_ASPFU	6.63e-196	15	441	25	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	6.72e-170	15	441	14	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	4.77e-90	18	441	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	7.00e-83	18	441	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.06e-43	22	441	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000060

TMHMM  Annotations     

Start	End
24	46
107	129
141	163
202	224
245	267
308	330
415	437