CAZyme Information: ACLA_044880-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_044880-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	DS027046|CGC1	42883.90	6.6593

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027046:627850-629044(-)

Full Sequence      

MLSEARFPPSLLRRLGAQCSRRRYQYCFGAAILIFILYHFQEAVVPLESRAKLTSHLSKP
SIAREVSARELLARPISRDPVTIPKIIHQTWFPAGSNMSGRAQAWVQTMREQNPDWEWVL
WDDQTNNMLVQQYFPWFWDEYAALPKEILRADLVRNFYMYLFGGMYADVDTEALIPVEPL
FTGHGTSLAAHKTILSSSHRSQNRRVQRAFMGRMAHSEDLMSSAAVPNGWMASPPGHPFW
LMAILFVLEHPEGTGDGSVEGLTGPGALSLMIKNYYAHSGAESMKQHVCHRIRQRQPSWS
LFCEEEYLNDERLHDALVLLPRQQIYPFSWADDQDSVCLAAHDNPLFNADECKRLMDVEA
WPSYFITYCTHSW

Enzyme Prediction     

No EC number prediction in ACLA_044880-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	103	180	5.3e-17	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.38e-21	28	291	25	259	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.12e-13	106	180	8	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65556.1|GT32	9.40e-171	20	373	11	362
QRD92713.1|GT32	1.33e-170	20	373	11	362
QMW36295.1|GT32	1.33e-170	20	373	11	362
QMW48351.1|GT32	1.33e-170	20	373	11	362
BCS10897.1|GT32	2.96e-162	10	373	10	371

PDB Hits     

ACLA_044880-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	8.23e-16	77	180	51	152	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	2.54e-14	80	275	59	223	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	5.03e-14	76	170	76	167	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	5.46e-14	29	275	17	229	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	6.40e-14	23	317	6	262	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000007

TMHMM  Annotations     

There is no transmembrane helices in ACLA_044880-t26_1-p1.