CAZyme Information: ACLA_044730-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_044730-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: fungal chitosanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
164	DS027046|CGC1	16945.46	3.7557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027046:589958-590497(-)

Full Sequence      

MDIDCDGANNSAGGCANDPSGQGQTAFMDTVSQYGISDLDANIHPYVVFGNSGSSPSFDP
QQYGMEPLSVMAVVCNNQLFYGVWGDTNGGIATGEASISLAKLCFPNDGITGDNGHGEHN
VLYIGFVGQDAVPGANAAWQAGDTNTFEGSIKELGDRLVARLSG

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	1	161	2e-64	0.6818181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.38e-99	1	161	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG44374.1|GH75	8.17e-103	1	163	79	241
QYT04861.1|GH75	1.33e-90	1	162	71	232
UKZ82772.1|GH75	3.10e-89	1	162	71	232
UKZ57039.1|GH75	1.26e-88	1	162	71	232
SMR60234.1|GH75	8.29e-88	1	164	75	238

PDB Hits     

ACLA_044730-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	1.86e-106	1	163	79	241	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q875I9|CSN_ASPFM	2.52e-82	1	162	75	236	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	3.22e-81	1	162	78	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	9.32e-77	1	162	79	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	9.32e-77	1	162	79	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ACLA_044730-t26_1-p1.