CAZyme Information: ACLA_044560-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_044560-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: Melibiase subfamily, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757		85322.97	5.7915

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027046:551437-553799(-)

Full Sequence      

MGNEAVAKEWWGLGYLYSTKHPSLVQHGTGSTPYNLGIEYDMRSQTITLENTCIRVTVLI
DKDGAAYLQEVLPLPAISPTPSSPNFSNSYCYLLEARLAGEGTARNKSSKSLVGSYVGSR
LRYQSHEFENRPDSRTLHVRLLDDVTGATVTSHLTIYHGFPVLRATATIQNGGDKDIVVT
QLSSLVLGGLSAGSNRWWHEYKLSVPTNSWFREAQWGEHDLPSLGIDDYGVYGRPEYHWG
TLGHYSVSNRGTFSTEGHLPMGLLKRNDEKDSWLWQIENNGSWRWEIGDWKDNIYLAAGG
PVETDHDWRQRLAPGEQFTTVAVALCHVHDDYQKAFSAITRYRRHMRRKHCDNERLPIIF
NDYMNCLMGDPTEDKILALLDPVVQAGAEYFVIDAGWYADDSGWWDDVGQWEPSKKRFPS
GFQELLARIEQKGLVPGLWLEPEVIGVRSVVANQLPDEGFFQRDGHRIVEKDRFQLDYRN
SAVRKHMSNVIHRLVTEYGVGYFKFDYNIDVTQGTDVNCSSSGSGQLEHNRAYLKWVNEL
HDQYPHLVIENCSSGAQRMDYAMLAVHALQSSSDQQDPERYPAIVSALPTAVAPEQGAVW
AYPQPVWDDELNAMTVVNSLLGRVHLSGRLDLLQPHQFALIKEGMDVYKVIRADLKTAIP
FWPLGLPHWHDDWVSLGMSAQTAEGQDSGCYYVAVWRRGGDGSMMLPIRALQGQDMQIQT
IYPSALATEVQWVASEGCLVVTIPSELGARLIKLMVN

Enzyme Prediction     

No EC number prediction in ACLA_044560-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	119	658	1.9e-95	0.7674418604651163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	2.30e-84	355	649	1	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	2.74e-31	342	591	27	293	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	1.24e-26	122	564	85	495	Alpha-galactosidase [Carbohydrate transport and metabolism].
269893	GH27	7.16e-09	360	434	5	80	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
374582	Melibiase_2	0.001	361	441	20	98	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE64621.1|GH36	0.0	45	754	5	714
QMW46905.1|GH36	0.0	45	754	62	771
QRD91154.1|GH36	0.0	45	754	62	771
QMW34832.1|GH36	0.0	45	754	62	771
UDD63863.1|GH36	0.0	45	754	5	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	1.36e-26	133	560	133	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	1.80e-26	133	560	133	538	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
6PHU_A	1.73e-25	133	652	143	642	SpAga wild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	7.01e-25	133	652	143	642	Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]
4FNQ_A	1.20e-24	129	624	125	586	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43467|AGAL1_PEDPE	5.91e-28	129	596	127	583	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
sp|G1UB44|MELA_LACAC	7.01e-26	133	560	133	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|Q9ALJ4|AGAA_GEOSE	1.08e-23	129	624	125	586	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
sp|P43469|AGAL2_PEDPE	2.43e-23	136	624	130	580	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
sp|Q5ARP5|AGALG_EMENI	4.03e-22	119	577	99	550	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ACLA_044560-t26_1-p1.