CAZyme Information: ACLA_043740-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_043740-t26_1-p1
• CAZy Family: PL4
• CAZyme Description: glycosyl transferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	DS027046|CGC5	44640.79	7.0961

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027046:351890-353302(-)

Full Sequence      

MPPRWRFKRQVIVSGVVLLAVIWLLLVLQEQPPVIEDQEFLLAKYVHSQEGKGGAWYIPN
SWLEDTTSPPQTIVEAAKLASRRAQALPQRQLPYSAIPLIVHQTWKNTQPETWSPAVRHS
TEQWLRAVETDGMAYFLWDDEGIKQFMLTFEPALQTQFYALSSNVERTDVFRILVSKWIG
GVYGDMDTEPLRNPAHWIDATDIQPWQDPRTNATYNSTASVRAIIGLEADCPPDGDSYWR
MGYTYPVQLTQWSFAWAPGHPILQRFVETWSARMRRMSSGAGMRDWDPLMLTGPAAFTEA
VQGVLNETAGLRWNALTGLEDGGRSCLVLVADEADSPGRGKYGNMGSKPLTDPSARLLHR
AQGSWRKFDLVVEYGKFCRTVFGRCRGWTKVPHS

Enzyme Prediction     

No EC number prediction in ACLA_043740-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.93e-13	68	272	62	245	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.98e-07	135	199	20	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW48355.1|GT32	1.32e-174	3	393	4	412
UDD65561.1|GT32	7.17e-172	3	393	4	412
QMW36299.1|GT32	2.90e-171	3	393	4	412
QRD92708.1|GT32	2.93e-169	3	393	4	414
CAK38082.1|GT32	6.07e-163	31	392	33	408

PDB Hits     

ACLA_043740-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.61e-22	91	366	135	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q10323|IMT3_SCHPO	1.32e-10	95	201	55	162	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P47124|HOC1_YEAST	1.17e-09	34	307	69	326	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000000

TMHMM  Annotations     

Start	End
12	29