CAZyme Information: ACLA_043020-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_043020-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: alphaN-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	DS027046|CGC1	48164.07	6.1910

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027046:178879-180566(+)

Full Sequence      

MGTKKGSVLPYRRGSGSSEADFFDIPDEPCLAIVKRQLRRIRTWIIFLVLVLLILWFRRE
PAPPPPVSHLDYDTVDWSRYAYSQYATSSAYLCNAVMVFEALDRLGSRAERVLFYPEGWD
LYVSDNRDRDSQLLQLAKEKYKVVLVPIDPSIIKPGEGSGESWDKSITKLLAFGETEYDR
LIHLDSDVTVLQEMDELFFLPPTKAAMPRAYWTLPETKQLSSLLVVIEPSYREFTALMER
AQPALYGQVDTSLDNDTQRYDMELLNSRYGDSALVLPHRQYGLITGEFRKKDHRYFLGND
YETWDPDKVLAEAKLVHFSDWPLPKPWVMWPQKLLAELLPKCDFKPGTSQEKGCRDREVW
KSLYQDFRQRRKVSNPTSALTKRELLLTLGLLGNSSYRASHSMIIDFEVDITALHGN

Enzyme Prediction     

No EC number prediction in ACLA_043020-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	84	329	1.9e-17	0.8638132295719845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	1.08e-112	80	367	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	9.13e-18	80	367	1	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	9.59e-10	78	201	69	191	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	2.26e-09	80	328	1	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
279798	Glyco_transf_8	0.001	124	327	41	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD92864.1|GT8	4.75e-212	1	394	1	390
QMW36162.1|GT8	4.75e-212	1	394	1	390
QMW48222.1|GT8	4.75e-212	1	394	1	390
UDD65407.1|GT8	7.16e-212	1	372	1	371
BAE66577.1|GT8	5.85e-211	1	372	1	371

PDB Hits     

ACLA_043020-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBL2|GNT1_ASPFU	4.87e-232	1	373	1	372	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q4HVS2|GNT1_GIBZE	3.61e-83	75	372	150	431	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q6FQ15|GNT1_CANGA	1.28e-33	75	373	86	486	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q6CT96|GNT1B_KLULA	6.94e-30	73	373	78	449	Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-B PE=3 SV=1
sp|Q12096|GNT1_YEAST	2.68e-29	73	373	85	488	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000035

TMHMM  Annotations     

Start	End
40	57