CAZyme Information: ACLA_035610-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_035610-t26_1-p1
• CAZy Family: GH134
• CAZyme Description: pectin methylesterase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		38655.39	8.2243

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027056:688741-689934(+)

Full Sequence      

MKFYLFLLPVVLHALLIHTAALPPLSRRVCQSSLRDCPEGIIIVSKSHPRAHFSTALAAI
ESLPNDESKQIILIQAGSYTEQLNVTRTGPITLLGQTDSANHDNTGKSVDNVFSSVLVVA
PTLVASYTGSGPTGYPVPEDTPFGNVDFRVYNIDFRNTWADYSDGPAHASSLSRANGGFY
SYQDTVYVGKLGNAYFYKNIIAGQTDFLYGFVTAWVQSSDVLLRNCGGGITATACTSYST
VNAANASIAPTIAGKCALGRPWNSLHRSIFANGYEDGSIQPSGYIDWVVSGVSRFSNDTV
MAEYKAFGPRSQRHGPQRRRRCDRARYEEVQALQLTQEGIPDARWQARKHRLD

Enzyme Prediction     

No EC number prediction in ACLA_035610-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	44	323	2.5e-40	0.9340277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215367	PLN02682	2.95e-17	38	315	67	339	pectinesterase family protein
178372	PLN02773	1.43e-16	50	312	14	271	pectinesterase
178051	PLN02432	1.54e-15	53	315	23	264	putative pectinesterase
395871	Pectinesterase	3.50e-14	53	313	12	271	Pectinesterase.
215280	PLN02506	6.00e-12	52	309	243	487	putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22782.1|CE8	5.21e-150	12	342	12	380
EAA60938.1|CE8	1.40e-147	12	309	12	341
BAE63594.1|CE8	1.59e-141	26	309	23	337
UDD62592.1|CE8	1.59e-141	26	309	23	337
QRD94539.1|CE8	1.29e-140	26	309	23	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.36e-16	33	284	2	245	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.85e-16	33	284	2	245	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT4|PMEA_NEOFI	4.88e-18	19	284	16	270	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	9.49e-16	14	284	11	273	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	3.15e-15	36	284	31	271	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.19e-13	19	284	16	270	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.19e-13	19	284	16	270	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999741	CS pos: 21-22. Pr: 0.9687

TMHMM  Annotations     

There is no transmembrane helices in ACLA_035610-t26_1-p1.