CAZyme Information: ACLA_033660-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_033660-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
948		105804.51	6.0500

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027056:120225-123250(+)

Full Sequence      

MSASQDSPSAKVLDGQPNPVIVGPGMKSLGEDAYTQAANVTPSLDTDKKHPVDSDAPSYF
ANIPDTQPSADVNSPATPADAAKSAKSPIELLHRLSLNRTPLVPDFDPREQYPGLNLTGR
FISAAFCIPYKVYYRPGSDWELKPRPGTSALFDSFAYLGSEETKWSHTLVGWTGEVEPIQ
ETPASLQQIPVNAGAKLPPALNGVAVPLSKAAAPVPVDSSQRPPSHPLLEGFTVPQEDRA
RLDGQLGSGRYGKIAPVWLSDESEEPEESSTIFLEDQGKWRRYAEKELYPLLHYKQHGPT
DGRSERKWWGDYVRMNRLFADRILEEYKEGDIVWIHDYHLFLLPSLLRQRIPNIYIGFFL
HAPFPSSEFMRCLAKRKEVLTGVLGSNMIGFQTFSYSRHFSSCCTRVLGFESNSAGVDAY
GAHVAVDVFPIGIDVKAIQKAAFGPANIENAVVALRNLYAGKKIIVGRDRLDSVRGVAQK
LQAFEAFLERYPEWRDKVVLIQVTSPTSVEEEKEDPENKIASQISNLVSTINGRFGSISF
SPVKYYPQYLSQHEYFALLRVADVGLITTVRDGMNTTSLEYILCQQNTHSPLILSEFSGT
AGPLSSAIHINPWDTIGVAEAINEALTMSPEEKRLQHVHLYKHVTTNTVLTWSNQFVTRL
LTNLSSFDQSVATPALDRATVLKQYRKARKRLFMFDYDGTLTPIVKDPQAAIPSDRVLRN
IKTLAADPRNAVWIISGRDQAFLDEWMGHIPELGLSAEHGCFIRKPRSDDWENLAESSDM
GWQKEVVEVFQHFTERTQGSFIERKRVALTWHYRRADPEYGAFQARECRKQLEETVAKRW
DVEVMAGKANLEVRPTFVNKGFIASRLVDEYGTGPGQAPEFVLCLGDDFTDEDMFRALKK
ANLPADHVYSVTVGASSKQTEASWHLLEPADVIGTISVLNNSSSAQEY

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	119	660	7.9e-155	0.968421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	120	660	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	235	932	57	716	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	9.26e-176	214	660	55	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	1.44e-158	277	660	98	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	2.08e-156	283	895	181	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46130.1|GT20	0.0	1	948	1	945
QMW34075.1|GT20	0.0	1	948	1	945
UDD62950.1|GT20	0.0	1	948	1	945
BCS16698.1|GT20	0.0	1	948	1	946
BCR91687.1|GT20	0.0	11	948	8	957

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	4.58e-180	671	941	1	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	2.93e-175	673	942	3	272	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXF_A	1.06e-146	115	663	27	526	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	5.30e-98	673	939	5	297	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HVM_A	5.24e-97	231	660	62	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	7.59e-235	120	939	15	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	2.19e-221	107	941	26	814	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q9P4D3|TPS2_ZYGRO	7.56e-212	120	939	10	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	2.40e-167	280	898	139	750	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O14145|TPS2_SCHPO	5.32e-166	139	932	36	842	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ACLA_033660-t26_1-p1.