CAZyme Information: ACLA_033220-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_033220-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: secreted glycosyl hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
188	DS027059|CGC6	20954.69	4.5603

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:4484022-4484794(-)

Full Sequence      

MELHISWWLLLALVSVSFGDTIQARIRGIDLFELHFPVNWKSQSMMGSGAKQADFFIEHG
GNWTADAYTLPGVLEMEGNIAGKLCHGMTPTEITDWMLDFSNRYKSRTGRPPILFLSAGW
WAKCADNNATFGADHALWLANWAEEMGTLPAGWKEATFWQYAGWDENGGEANVFLGSSKE
LVEFAIGS

Enzyme Prediction     

EC	3.2.1.17:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	48	162	3.1e-23	0.5875706214689266

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119374	GH25_CH-type	1.28e-62	48	181	67	199	CH-type (Chalaropsis-type) lysozymes represent one of four functionally-defined classes of peptidoglycan hydrolases (also referred to as endo-N-acetylmuramidases) that cleave bacterial cell wall peptidoglycans. CH-type lysozymes exhibit both lysozyme (acetylmuramidase) and diacetylmuramidase activity. The first member of this family to be described was a muramidase from the fungus Chalaropsis. However, a majority of the CH-type lysozymes are found in bacteriophages and Gram-positive bacteria such as Streptomyces and Clostridium. CH-type lysozymes have a single glycosyl hydrolase family 25 (GH25) domain with an unusual beta/alpha-barrel fold in which the last strand of the barrel is antiparallel to strands beta7 and beta1. Most CH-type lysozymes appear to lack the cell wall-binding domain found in other GH25 muramidases.
395941	Glyco_hydro_25	1.19e-21	46	161	63	171	Glycosyl hydrolases family 25.
119373	GH25_muramidase	2.95e-20	47	163	64	170	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
119384	GH25_YegX-like	2.73e-10	28	161	36	174	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
128889	Glyco_25	1.18e-04	48	88	68	109	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17651.1|GH25	1.23e-76	1	187	1	235
EAA58427.1|GH25	7.20e-73	1	163	1	218
QIS69361.1|GH25	1.87e-43	49	187	141	279
QNJ46237.1|GH25|3.2.1.17	6.72e-43	19	185	65	222
VWP02526.1|GH25	1.73e-42	48	187	94	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZM8_A	2.19e-35	19	187	48	207	Chain A, muramidase [Sodiomyces alcalophilus]
6ZMV_A	2.38e-34	19	188	48	207	Chain A, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
1JFX_A	1.73e-33	48	185	71	213	Crystal structure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
2X8R_A	1.71e-28	19	187	50	210	The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ANU4|LYS_ARTBC	1.44e-35	48	187	95	234	N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05911 PE=1 SV=1
sp|P25310|LYSM1_STRGL	5.35e-32	48	185	148	290	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
sp|P00721|LYS_CHASP	2.38e-31	48	187	71	211	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999756	CS pos: 19-20. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in ACLA_033220-t26_1-p1.