CAZyme Information: ACLA_033130-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_033130-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997	DS027059|CGC1	110698.66	5.7623

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:4458833-4462552(+)

Full Sequence      

MTMLSPTSDHPQGASMKDIENPGNDSPALEGSTQAEKTVDNPSRSPTPQLQTAELAQVLS
PLAVRQTQSISTRSQHNRLEYLCLPNATNRGKLSRSLARRATLLGWFDQAATQSGQESQS
SVCVAVKLPDDGYSFSPSNITPALSKAITRLNEMAVVALSSRVVDKGLSGILPGQKSFLV
ESTSTRIPIVATLDDVEPTLAHYSRACIVMEQKIVLVWSHDTAGILNVAYDVETQLGGQS
PKISNATTPRISGRSTPMDPYRTDDLQKPANVLQPVRGALDEKQAIYSKAVALEEGEDNE
VPDLERNAAPRPVLLVHTVKISLAIMLVIVTQSLGVARLLNEFQWDGQYTRFALVVTIPP
LALFSLFFFIVLVTSVFQLFLPASFCLKNSKFHSGDTEDSSAVKPNPKAHGEYELPHITI
QMPVYKEGLKGVIVPTMISVLAAVQYYEEQGGTASVFVNDDGMQVIQSDLAEARKQYYRE
NGIGFTARPPNKKSPVQKGGWGSWFRKSKPATTEPADSEEPEGPYTPQALANKIGFERKG
KFKKASNMNYGLAFSLRVEDELARLTQIETERRGCTVDDLTAEDDDRLYQQALDNMLAAD
EERTWAEGNIRIGELILLIDCDTRVPVDCLLYGALEMHESPEVAILQHGSGVMQVVHNVF
ENGITYFTNVVYTAIKYGVGSGDVSPFVGHNAFLRWRALQSIEFVDPSDGQTKWWSDTHV
SEDFDISLRLQMQGMVVRLATYHNGEFKEGVSLTLYDELTRWEKYAYGCNELVFHPFYQW
VYKGPVTRLFLRFLWSNMPVTSKVTIIAYIFTYYAIGSGMLLATVNYVILGLFDSDIDHL
YLPSWGIWCSLVVVFNGFSSIAFSMVRHQLKEETFWRALLDAIKWLPFLIIYFGGISLNC
AKAILCHAFSINLEWASTAKEMGPTGFYIGMDKMVRRFKWTWAICLVLAGVMIYFAVGAP
WGWTITPGPYSTANVAIAPLAIQICSASFLPFFLGLN

Enzyme Prediction     

No EC number prediction in ACLA_033130-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	616	823	2.4e-52	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.08e-52	615	822	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	6.29e-10	613	915	138	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.15e-05	613	723	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97459.1|GT0	0.0	86	997	89	984
CZS73743.1|GT0	0.0	93	997	96	986
CEF83741.1|GT0	0.0	93	997	96	986
QPC62761.1|GT0	0.0	72	997	63	973
UPK99959.1|GT0	0.0	69	997	56	963

PDB Hits     

ACLA_033130-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

ACLA_033130-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000001

TMHMM  Annotations     

Start	End
321	340
352	374
807	829
841	863
878	900
942	964
974	996