CAZyme Information: ACLA_029060-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_029060-t26_1-p1
• CAZy Family: GH105
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624	DS027059|CGC23	71348.28	7.3681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:3306368-3308301(+)

Full Sequence      

MRLLRLLLLLAIATLAGLSIVLLKGNGDLNVATNRSPFGHTSLNDAQQLQQASPPEQRPH
PPPQTPPPPPPQQQQQPATVAESSTPTNRHPIADLIENAEQQFNGLYSRQSKSLAEAVNE
YRRRYNMHPPPHFDKWFKFAQSKGVQLIDEFDTIYHSLLPFWGIDPKTIRSRARETLGYD
NAVIGLLIRNGKASLVEGGGDGHQWQRDATVGMMKEFVQYLPDMDLVFNIHDEPRVVVPS
DDLQRLVNLAKGHVLPKSFQNQSPKNSWSSRPKDLNKGDRIDGMRTTRFNRYAHQATWTN
SRASCPLDSPVRSLDENAPDNVGAYRRGELGFIFNTTAFSDICNTPSLRKTYGFFDRPNA
FDVVHDLFPIFSQSKISSFQDILYPSPWYWANKVPYSEDKDYAWEEKQDKMYWRGSTTGG
FSRAGGWRRQHRQILVTNMNSLNNAKVLAKKTDGQWVTKDVRRKEYSDLFDVKFTFIGQC
DPDDCAAQLEFFEVVGPAGQQDAWAYKYLVDIDGNAFSGRYYAFLHSNSLVCKVAIFREW
HDEWIKPWLHYVPMSLAGEESVETMRYFVSEAEGKTAATSIAKNGQSWAQKALRNEDIEV
WFFRLLLEYGRLVDDNRENLGFFL

Enzyme Prediction     

No EC number prediction in ACLA_029060-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	345	613	9.5e-83	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	6.95e-22	365	612	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.37e-12	369	612	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83603.1|GT90	8.42e-314	78	624	54	600
UCK57446.1|GT90	3.97e-312	77	624	72	619
BAE54850.1|GT90	1.58e-311	77	624	62	609
QQK41201.1|GT90	1.47e-307	86	624	55	591
CAP94438.1|GT90	2.92e-305	86	624	56	592

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.35e-09	346	616	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	4.97e-08	369	613	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.25e-54	90	619	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	5.12e-10	369	613	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	3.58e-09	346	616	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	1.53e-08	369	613	164	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8BYB9|PGLT1_MOUSE	2.59e-08	346	616	123	373	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.863119	0.136893

TMHMM  Annotations     

There is no transmembrane helices in ACLA_029060-t26_1-p1.