CAZyme Information: ACLA_026560-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_026560-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: DUF1680 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666	DS027059|CGC16	76287.76	6.2964

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:2518313-2520656(-)

Full Sequence      

MEYPQESFKATTFASGSFWANRRHVVQSQTLRHQLQMLKKTGRYDAFKLKWHPSYSDPCT
VWPVPNHQFWDSDVAKWIEGACYFLTEFPGEEIDMAVRELVGMIQSAQQPDGYLNIHYTV
VELGKRFTNLRDMHELYNAGHLIEAAIAHRLHYKNDELLLPIVRYVALLAATFGNQEGQK
PGYPGHPEIELALLRLYRVTQDPEHFRLARFFLEERGNPASGKERRHYYDIEAEARGERE
HEVPAAYPAARSYWYQQAHMPITQQKKIEGHSVRAMYLLTSVADLVRISKADSEVGAKFL
PALERLWSNMVEQKSYVTGGIGAIKQWEGFGVDYFLPHGTDEGGCYAETCAAIGVMMLAE
RLLQIKLDGQYADIMELCLYNAVLTGMSLDGKAFTYVNQLASSEADLSRRYEWFECACCP
PNVTRTLGYLGGYVWSYEVDDKARKGTINVHLYTSASLRFQIASSTIEVAQQTEWPWKGD
VSFSVTVDGPPVNLELRLRIPGWAIAWEINPRPPQLNIRDGYLYLDSDWTQQHPDFRFSC
PMRPKVLRPNPLTMQPVAYVTRGPIVYCVEDVDNDWEDDHFKRTIFDQDAPLLEEVRSTP
DQYVAIIAQKGVREILDISPWRRQIVAERGSAIPITDELKDLCFIPYYLRANRGGKGQMR
VGLRVA

Enzyme Prediction     

EC	3.2.1.185:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	16	568	8.6e-167	0.9904580152671756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	6.99e-130	16	664	20	586	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	1.74e-115	17	568	7	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT01986.1|GH127	3.05e-283	1	664	1	660
ATZ54433.1|GH127	1.14e-276	1	664	1	660
CCD50963.1|GH127	4.82e-274	1	660	1	656
UJO16417.1|GH127	3.06e-261	1	664	1	679
QIW96336.1|GH127	8.44e-260	1	664	1	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.94e-122	69	661	74	643	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.60e-117	69	654	74	637	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	2.68e-91	3	665	5	625	The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WKW_A	1.71e-80	69	666	73	659	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	1.87e-80	69	661	73	654	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	9.63e-80	69	661	73	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ACLA_026560-t26_1-p1.