CAZyme Information: ACLA_022980-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_022980-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: endoglucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	DS027059|CGC26	35499.56	6.2159

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:1457345-1458376(+)

Full Sequence      

MSVTKIAGILLGSAAMVAGHGFVTGAVVDGTYHTGYLVNNYPYSSNPPKTIGWSETATDL
GFVDGTGYASGDIICHKNAKPGALSADIKAGGKVEFQWTQWPESHHGPVITYMANCNGDC
ASVDKSQLEFFKIEEKGLIGSGHWASDDLIANNNSWTVTVPSSLAAGNYVMRHEIIGLHS
AGNANGAQNYPQCINLKVTGGGSDKPVGTLGTKLYKATDPGILVNIYGSLTSYTIPGPAL
WTGASSGGSDDNGSTPASTPTPTAAPSSTAAPSVTITSTPGQKTQTPVATPAPSTPSSTP
GLPTDGNLTDYFKSLSPEQFLSVLKETFSWLVTEKVHARSLSA

Enzyme Prediction     

EC	1.14.99.54:5	1.14.99.56:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	10	228	4.6e-72	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397484	Glyco_hydro_61	1.83e-101	21	233	1	211	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.
410622	LPMO_AA9	1.91e-93	20	241	1	216	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.
402954	Med3	4.84e-06	229	303	120	201	Mediator complex subunit 3 fungal. Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor.
183854	PRK13042	2.75e-05	240	304	16	91	superantigen-like protein SSL4; Reviewed.
273167	rad23	2.76e-05	254	299	93	138	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAF31975.1|AA9	5.36e-172	1	343	1	373
EAW22610.1|AA9	3.63e-159	1	343	1	367
BCR86354.1|AA9	2.78e-140	1	342	1	338
CAK45495.1|AA9	1.65e-139	1	343	1	402
BCR97220.1|AA9	3.54e-139	1	343	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OVA_AAA	1.51e-141	20	243	1	228	Chain AAA, Endoglucanase, putative [Aspergillus fischeri NRRL 181],7OVA_BBB Chain BBB, Endoglucanase, putative [Aspergillus fischeri NRRL 181],7OVA_CCC Chain CCC, Endoglucanase, putative [Aspergillus fischeri NRRL 181],7OVA_DDD Chain DDD, Endoglucanase, putative [Aspergillus fischeri NRRL 181]
2YET_A	2.20e-118	21	243	2	228	Thermoascus GH61 isozyme A [Thermoascus aurantiacus],2YET_B Thermoascus GH61 isozyme A [Thermoascus aurantiacus],3ZUD_A Thermoascus Gh61 Isozyme A [Thermoascus aurantiacus],7PU1_AAA Chain AAA, Gh61 isozyme a [Thermoascus aurantiacus],7PU1_BBB Chain BBB, Gh61 isozyme a [Thermoascus aurantiacus]
7A8V_A	9.80e-113	20	244	1	229	Chain A, Lytic polysaccharide monooxygenase [Talaromyces verruculosus]
6HA5_A	1.90e-112	21	241	2	227	AFGH61B L90V/D131S/M134L/A141W VARIANT [Aspergillus fumigatus Af293],6HA5_B AFGH61B L90V/D131S/M134L/A141W VARIANT [Aspergillus fumigatus Af293]
5X6A_A	3.60e-110	20	241	1	227	Crystal structure of an endoglucanase PMO-5 [Aspergillus fumigatus Af293],5X6A_B Crystal structure of an endoglucanase PMO-5 [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q9T3|CEL61_MYCTT	4.18e-87	4	246	2	248	Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Cel61a PE=1 SV=1
sp|O14405|GUN4_HYPJE	4.45e-87	3	243	2	248	Endoglucanase-4 OS=Hypocrea jecorina OX=51453 GN=cel61a PE=1 SV=1
sp|Q7Z9M7|GUN7_HYPJQ	1.01e-75	14	243	14	249	Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel61b PE=1 SV=3
sp|Q00023|CEL1_AGABI	4.10e-40	14	260	24	267	Cellulose-growth-specific protein OS=Agaricus bisporus OX=5341 GN=cel1 PE=3 SV=1
sp|Q4WBU0|EGLD_ASPFU	1.79e-34	66	249	53	240	Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000399	0.999559	CS pos: 19-20. Pr: 0.9630

TMHMM  Annotations     

There is no transmembrane helices in ACLA_022980-t26_1-p1.