CAZyme Information: ACLA_022900-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_022900-t26_1-p1
• CAZy Family: PL20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	DS027059|CGC27	42977.45	4.9972

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:1420592-1421725(+)

Full Sequence      

MQSIQVILKTGATEALNKLPAHLSTILPCLPNTILFSDFEETINGSTTLDVLRAVDEDLK
STHPDFDLYRRLQHTGRAALTRSDLTDDPSTPSGKPTNPGWKLDKWKFLPMINETFHLRN
DADWYLFMEADTYIFWSNLASWLGKLNAQEPFYLGNQVQIGDVVFAHGGSGFVLSRPAME
KVLGEYVARKSEWEEYTDKHWAGDCVLGKALADSGVKLSWSWPMLQGDTPGEFDYFGKGY
GKRSWCVPAVAWHHMTPEEIREMWVFDRRWSSIRPLMHQDVLYEVIMPKLGHRKEDWDNL
SGDGDGESAESVEDCENKCVGDAECLQYSYKEGHCHISRRMKRGAEKSGMTSGWMMERIN
GTVERQGDCEEIGWITF

Enzyme Prediction     

No EC number prediction in ACLA_022900-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	0.006	124	208	87	184	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD60864.1|GT31	1.45e-154	1	376	63	441
BAE61153.1|GT31	1.18e-153	1	376	63	441
QRD90967.1|GT31	3.37e-153	1	376	63	441
QMW43934.1|GT31	1.37e-150	1	371	63	436
QMW31901.1|GT31	2.23e-149	1	371	63	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	2.73e-07	82	267	65	231	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0VC84|C1GLT_BOVIN	7.15e-07	117	263	157	319	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q9JJ06|C1GLT_MOUSE	1.66e-06	94	253	133	286	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
sp|Q7K237|C1GLT_DROME	1.77e-06	82	267	137	303	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=C1GalTA PE=2 SV=1
sp|Q9JJ05|C1GLT_RAT	2.95e-06	94	296	133	355	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1
sp|Q9NS00|C1GLT_HUMAN	3.92e-06	117	253	157	286	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ACLA_022900-t26_1-p1.