CAZyme Information: ACLA_019180-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_019180-t26_1-p1
• CAZy Family: CE1
• CAZyme Description: beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	DS027059|CGC21	55858.99	4.9233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:337367-339002(-)

Full Sequence      

MPSVTPLPSTFKWGFATAAYQIEGAVHEDGRGQSIWDTFCHLEPSRTKGANGDVACDHYH
RYEEDFDLLTRYGAKEYRFSIAWSRIIPRGGRDDPVNEAGIAFYNRLIDSLLERGITPWV
TLYHWDLPQELHDRYGGWLDVEESQKDFERYARVCYERFGDRVKHWITLNEPWIVSIFGY
ATGGNAPGRSSTNPQSTEGNTATEPWIVGKALIMSHARAAALYNREFRQSQQGQIGISLN
GDYYEPWDAQDERDRAAAERRMQFHIGWFADPIFLAQDYPACMREQLGDRLPGFSPSDFA
MLREAELDFYGMNYYTSQYARHRDEPAPETDYIGNVDECQENNQGLPVGEPSGVHWLRSC
PDKFRKHLTRVYRLYGKPIYITENGCPCPGEDRMTCEEAVKDTYRLRYFEEHLEAVGVSN
AEDKADIRGYFAWSLLDNLEWSDGYGVRFGVTFTNYETLERTPKQSALSLKRIFEERIGA
DPSRA

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	476	2.2e-158	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	1.20e-169	6	475	4	449	Glycosyl hydrolase family 1.
274539	BGL	4.95e-168	8	468	1	424	beta-galactosidase.
225343	BglB	2.83e-143	7	477	4	453	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	8.14e-106	7	467	28	473	beta-glucosidase
215455	PLN02849	2.43e-104	8	467	31	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI22858.1|GH1	5.14e-306	1	481	1	481
QKD61576.1|GH1	1.75e-299	1	480	3	479
QPC64692.1|GH1	8.96e-297	7	479	4	476
AZK36092.1|GH1|3.2.1.21	1.74e-296	7	478	6	477
QLI67917.1|GH1	8.00e-296	7	479	8	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KHT_A	9.37e-287	2	477	16	491	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]
5JBO_A	4.47e-285	7	477	8	478	Trichoderma harzianum GH1 beta-glucosidase ThBgl2 [Trichoderma harzianum]
6EFU_A	1.20e-180	7	481	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	4.54e-178	7	481	3	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	8.75e-178	7	481	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	4.81e-180	7	485	11	482	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	7.13e-163	3	478	2	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	9.39e-141	3	483	18	520	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	1.03e-140	8	475	51	520	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q9FIW4|BGL42_ARATH	2.32e-134	8	467	22	472	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ACLA_019180-t26_1-p1.