CAZyme Information: ACLA_018770-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_018770-t26_1-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	DS027059|CGC11	42430.45	8.6820

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:227772-228939(+)

Full Sequence      

MAAYGLSATDHVFGTISPKKRSSIRFLPRCRRKWAILIFTIFLYILLQHLPSAPQFGNDA
RVNRPPPKYDVETTPRFLYHSPFRQSPNHTFESEVSNALLLIEKATLSLKGESIVAKQRI
WQAGLGLKERSEDSRVFEHENSDWEFQVVTDDWAVAFIRRTLTVVPCLWKLYTSYPYNVL
RVDLLRYLLLWYYGGYYADMDVFPARSINSCPALQQHFSEEAGNVSLILGIEIDEPYASP
RLMREWHWSRSYGFIQYTMRAPRRFSPLLSEAIVRVLAHTKQHLEQSSMFHGPRYDETTI
LEITGPGVFTDAILDHLSATLPPTVLPVSVWGNGQRHSGAEGFDSTQACINNRFGKSWKK
GWWEYLFG

Enzyme Prediction     

No EC number prediction in ACLA_018770-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	139	211	2.4e-17	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	1.35e-04	141	213	15	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP98643.1|GT32	9.10e-133	32	368	18	421
QMW37982.1|GT32	2.75e-122	63	368	47	413
QMW25899.1|GT32	2.75e-122	63	368	47	413
QRD88070.1|GT32	2.75e-122	63	368	47	413
UCK58385.1|GT32	2.75e-122	63	368	47	413

PDB Hits     

ACLA_018770-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	3.19e-15	112	321	95	307	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.71e-14	120	359	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	6.67e-13	118	321	98	360	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	9.81e-11	129	331	145	338	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000026

TMHMM  Annotations     

Start	End
34	51