CAZyme Information: ACLA_018400-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_018400-t26_1-p1
• CAZy Family: CBM48
• CAZyme Description: long chain fatty alcohol oxidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	DS027059|CGC4	82212.61	7.0497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027059:133562-135933(-)

Full Sequence      

MAEQTVTAYVPLDVSLPPIPTEQVFSDLQWKTLLALADTVIPSVRSPSSPKSLSTKVVPD
CDLKAAVSTLASHMHDPEATKIAEQYLEETGSANPLFVEGLRRLFAEYIHQEGRNGISLI
LNALNSKAGSLLLTGSITAIQDQPFEVRERVFRSWETSRIKPLRAIYRAFTAIFKKTWIS
VSPTIRLVVGFPRVPIHGKPADGFEYKFLQFPPGDKPEIIEADVVIVGSGCGGSVAAKNL
AEAGYKVLVVEKSYHYPSKHFPMDFTEGFVNMFETGGATMSDDGSMAVLAGSTWGGGGTV
NWSAALQTQGYVRREWASNGLPFFESFEFQQSLDHVCERMGVSSEHTKHNFANRILLDGA
RKLGYAAKPVPQNTGGTAHYCGYCTMGCHSTDKKGPTETFLADAADAGATFVEGFRAEKI
LFKKTKGGRVASGIQGTWTSRDSYLGTTGMDRETREVIIKADKVIVSCGTLQSPLLLMRS
GLKNPQIGRNLYLHPVVLSAAVFEEEIRPWEGAALTTVVNEFENQDNQGHGVKIENVAML
PAVYLPTFPWRDGLDYKLWAAKLPRMTGFIALTKERDAGRVYPDPVDGRARISYSVSAYD
RKHIVEALVATAKIAYISGAKEFHTTSREMAPFIRPADASDPNAPEGVNNEALQAWIAEL
RRQNPVDPERTLYASAHQMGTCRMGASSSTSVVDPNCQVWGAKGLYVMDASVFPSASGVN
PMVTNMAIADWASQNVAEMLKREKSESLMARL

Enzyme Prediction     

No EC number prediction in ACLA_018400-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	222	737	1.7e-61	0.9635036496350365

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	3.21e-60	272	496	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	4.33e-50	221	744	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.33e-31	576	729	2	140	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	4.04e-19	222	737	1	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	2.66e-09	221	733	5	528	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	9.38e-205	1	747	1	741
BAE61169.1|AA3_1|AA8	7.09e-17	223	736	255	786
UJO19303.1|AA3_1|AA8|CBM1	7.86e-17	223	736	273	805
QMW43910.1|AA3_1|AA8	2.26e-16	223	736	309	840
QMW31885.1|AA3_1|AA8	2.26e-16	223	736	309	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	3.92e-09	217	736	225	763	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
6F97_A	2.11e-08	223	730	7	521	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
7DVE_A	6.36e-08	672	738	439	506	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
4UDP_A	8.41e-08	223	730	7	521	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
2JBV_A	1.96e-07	410	730	225	520	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	8.63e-98	61	743	39	749	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	2.04e-89	220	744	235	748	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	1.48e-87	92	743	62	745	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9LW56|FAO3_ARATH	1.98e-87	29	738	19	738	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|O65709|FAO4A_ARATH	6.83e-86	220	744	222	726	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ACLA_018400-t26_1-p1.