CAZyme Information: ACLA_017480-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_017480-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: glycosyl hydrolase family 62 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		28966.94	9.6471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027049:2481464-2482282(+)

Full Sequence      

MVHSILLYTFLALSVFLSPVFAEARSPGCGKLPNLSNGVHKINGREYTLKVPSNYDKNKA
YHLVFGLHWRGGNMGAVVKGEGVQPWYGLEKRAHGSAIFVAPNGKSAGWANTGGQDIAFL
DAIIKEVESNYCVDQSSRFATGFSWGGGMSYALACSRAKQFKAVSVLSGGLISGCSGGND
PIAYLAIHGIKDNVLPFNGGISLANRFVKNNRCHQSEIHTPKSGSRSSVRTDFRGCSKPV
SFIAYDGGHDAAPLGVGSSLAPDATWKFFMAA

Enzyme Prediction     

No EC number prediction in ACLA_017480-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	45	173	9e-24	0.5814977973568282

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	2.13e-21	44	269	46	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
226584	COG4099	1.38e-06	47	203	176	337	Predicted peptidase [General function prediction only].
223489	DLH	7.12e-06	120	219	96	196	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
395613	Esterase	1.27e-04	44	169	5	143	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
223477	YpfH	0.001	113	207	76	172	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX54170.1|CBM1|CE0	4.21e-87	22	269	90	352
QSB17085.1|CBM2|CE0	4.18e-85	28	269	38	285
BCJ61433.1|CBM2|CE0	2.68e-80	24	269	55	321
AEB46202.1|CBM2|CE0	3.94e-80	24	269	18	279
QUC63414.1|CBM2|CE0	7.70e-79	19	269	31	296

PDB Hits     

ACLA_017480-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CC33|FAEC2_ASPCL	2.72e-203	1	272	1	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1
sp|A4D9B6|FAEC_ASPFU	5.24e-160	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=faeC PE=3 SV=1
sp|B0XU32|FAEC_ASPFC	5.24e-160	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=faeC PE=3 SV=1
sp|A1DI08|FAEC_NEOFI	3.52e-158	1	272	1	272	Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=faeC PE=3 SV=1
sp|A1C9D4|FAEC1_ASPCL	8.78e-152	1	272	1	272	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999762	CS pos: 22-23. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in ACLA_017480-t26_1-p1.