CAZyme Information: ACLA_010450-t26_1-p1

Basic Information

• Species: Aspergillus clavatus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus clavatus
• CAZyme ID: ACLA_010450-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	DS027049|CGC6	92243.40	4.9026

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AclavatusNRRL1	9428	344612	287	9141

• Gene Location: location=DS027049:515357-518009(+)

Full Sequence      

MVQFDVEKTLEELTLGEKVALTAGTDFWHTAAVPRLNIPSLRMSDGPNGVRGTRFFNGTR
AACFPCSTALGATWDTELLYEVGRLMAEESIAKGSHIILGPTINTQRSPLGGRGFESFAE
DGVLSGLLAGNYCKGLQDKGVAATLKHFVCNDQEHERLAVDSIVTMRAMREIYLMPFHLA
MRLCKTACVMTAYNKINGTHVSENKQIITDILRKEWGWDGLVMSDWFGTYSTSDAINAGL
DLEMPGPTRWRGTALAHAVSSNKAFEYVLDERVRNVLNLHNFVEPLGIPENAPEEALNRP
EDQALLRRAAAESVVLMKNEDNILPLKKEKSILVIGPNAKTAAYCGGGSASLDAYYTVAP
FDGVKAKSEGEVSFSQGVYSYNELPVLGPLLKTEEGEKGFKFRVYNEPSSNPNRELLDEL
RLENSLGFLMDYKHPKVTSFLFYADMEGYFTPEEDGIYDFGVTVQGTGKLYIDGELVVDN
SKNQRQGTAFFGNATVEEKGSKELKAGQTYKVVVEFGSAPTSDLDMRGVVVFGPGGFRFG
AARRVGQEELISKAAELASQADQVVIFAGLTSEWETEGHDRDHMDLPAGSDEMISRVLDA
NPNAVVVIQSGTPVTMPWAHKTKALLQAWFGGNECGNGIADVLYGDVNPSAKLPLSFPVR
LQDNPSYLNFRSERGRVLYGEDVYVGYRYYEKVDLAPLFPFGHGLSYTTFSRSDLSLATV
PEKRQLEDGEPITATVTVTNTGDVAGAEVVQLWIVPPPTGVNRPVRELKGFAKVFLNPGE
SKTVEIVVEKKLATSWWDEQREKWASEKGTYKVLVTGTGDEVLKSSFEVEKTRFWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	245	3.9e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.37e-88	35	828	101	763	beta-glucosidase BglX.
224389	BglX	4.21e-75	1	376	10	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.03e-55	314	707	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.87e-45	35	279	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.00e-42	13	789	60	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA36818.1|GH3	0.0	1	838	1	838
BAE61980.1|GH3	0.0	1	838	1	839
QMW44618.1|GH3	0.0	1	838	1	839
QMW32588.1|GH3	0.0	1	838	1	839
QRD84089.1|GH3	0.0	1	838	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.68e-278	1	838	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.20e-272	3	838	3	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.05e-157	5	832	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.82e-118	9	815	8	648	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	8.20e-106	12	829	60	826	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	0.0	1	838	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	0.0	1	838	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q5AV15|BGLJ_EMENI	0.0	22	838	51	850	Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglJ PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	0.0	1	838	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	1	838	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998070	0.001957

TMHMM  Annotations     

There is no transmembrane helices in ACLA_010450-t26_1-p1.