CAZyme Information: MGYG000004902_01117

Basic Information

• Species: An23 sp900545755
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; An23; An23 sp900545755
• CAZyme ID: MGYG000004902_01117
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		40037.67	7.1215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004902	2322562	MAG	Spain	Europe

• Gene Location: Start: 7575; End: 8660 Strand: +

Full Sequence      

MQAAVPFIKAAREDGWDGPFVISTTTQTGKAMAERLGKDLYDLHIYYPWDKSLFVRRALD
ALNPAAFAAAETELWPNMLYECRVRGIPTFLINGRISDRTWARVQGGLRRPLARGAYSLF
SSLFLRDEEDRERLTRIGVEGKKLFVMGDGKIDALLARRNEAARDKLAAELGEPERPIFI
AGSTHTGEDEKVLAAFAVLRAHHPEARLVIAPRHPERAAAVASLVPEEYRTAMFSSLTAG
WDVLIIDRIGVLFDLYGTARSAFVGGSFADKGGQNILEPFSWGVPVQYGPHMEDFAHASR
AFLAMGAASQVSDEDGLACAWLAVAEEGESGREKWLALSREYFDKSRGASARTWKIIKKY
L

Enzyme Prediction     

No EC number prediction in MGYG000004902_01117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	2	153	5.3e-37	0.8361581920903954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	4.30e-94	3	361	65	421	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	4.62e-90	3	361	64	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	5.48e-44	3	154	28	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
cd03786	GTB_UDP-GlcNAc_2-Epimerase	0.006	128	286	150	300	UDP-N-acetylglucosamine 2-epimerase and similar proteins. Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family (EC 5.1.3.14) are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to produce an activated form of ManNAc residues (UDP-ManNAc) for use in the biosynthesis of a variety of cell surface polysaccharides; The mammalian enzyme is bifunctional, catalyzing both the inversion of stereochemistry at C-2 and the hydrolysis of the UDP-sugar linkage to generate free ManNAc. It also catalyzes the phosphorylation of ManNAc to generate ManNAc 6-phosphate, a precursor to salic acids. In mammals, sialic acids are found at the termini of oligosaccharides in a large variety of cell surface glycoconjugates and are key mediators of cell-cell recognition events. Mutations in human members of this family have been associated with Sialuria, a rare disease caused by the disorders of sialic acid metabolism. This family belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ45975.1	1.27e-186	1	361	51	410
QVL37654.1	4.52e-100	1	361	44	399
QTX33768.1	4.52e-100	1	361	44	399
ADE57609.1	6.82e-96	1	361	45	400
AER66296.1	7.66e-92	1	359	43	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.37e-29	39	317	87	336	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AC77	1.99e-41	3	295	63	355	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC76	1.99e-41	3	295	63	355	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P0AC75	1.99e-41	3	295	63	355	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P44806	4.06e-40	3	361	65	423	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q8R6G8	1.71e-33	21	333	71	384	Bifunctional glycosyltransferase/methyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) OX=190304 GN=trmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004902_01117.