CAZyme Information: MGYG000004901_00622

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004901_00622
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		37067.43	8.4351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004901	2471011	MAG	China	Asia

• Gene Location: Start: 820; End: 1857 Strand: +

Full Sequence      

MMSLRSAISAGLLVLCCSVPAVAADAWVAEWDMPNGLAELRQGNFKNIFMFAAYFDRQDR
PYLTEDMQKALRGGLAASLAQSPNKGPGVYLSVVNDLLVEAPGKSIQKDPGIVSRLMATE
ASRAAHRKDLLALLSVYPFTGLEIDYERVNIDDWPRLLQFAQELSVTLAAQGKKLRVVLE
PKQKYLQGSLPAGPQYVVMAYNLHGNHNGPGAKADDAFLRKLAQWCAHWPVKPGLALSAG
GYAWTARGVVDLTERKAAAWAQGAGVQPIRDPASHALYFKAADNSPGSPLLAKGGTTGGS
CEIWYADGETLASWAELGRSLGFGDVSLWRLGGNTPESLAKISGK

Enzyme Prediction     

No EC number prediction in MGYG000004901_00622.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	107	336	2.4e-16	0.7195945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06549	GH18_trifunctional	1.36e-31	113	336	79	295	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02874	GH18_CFLE_spore_hydrolase	5.54e-17	109	332	74	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.09e-08	109	345	178	421	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	9.87e-08	109	333	75	306	Glycosyl hydrolases family 18.
cd00598	GH18_chitinase-like	0.001	116	203	82	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO41708.1	2.84e-219	4	345	4	340
AYB45334.1	4.17e-71	22	344	44	353
AWP30943.1	1.80e-70	22	343	37	345
AVV60320.1	7.16e-70	22	343	37	345
ANA81893.1	8.27e-70	22	343	42	350

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000984	0.790799	0.207309	0.000330	0.000299	0.000257

TMHMM  Annotations     

start	end
7	29