CAZyme Information: MGYG000004896_02443

Basic Information

• Species: Eggerthella sinensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Eggerthella; Eggerthella sinensis
• CAZyme ID: MGYG000004896_02443
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000004896_58|CGC1	27770.49	4.8023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004896	3996684	MAG	China	Asia

• Gene Location: Start: 9831; End: 10583 Strand: +

Full Sequence      

MARTTQRTSQAHPFVAFLGRVGLVVFILIVLVEVYFLARGFNLYREALEATDLNDMAAAI
QNSENFTPIDELPDLYLQAVVAVEDHRFYAHPGFDIIATGRALMNDLKAGAIVEGGSTIT
QQLAKNQYFSQEQTIDRKIAEIFMAVTIEQHFSKRTILELYVNSIYFGDGYEGIGNASEG
YFGKDPSALDADECTLLAGIPNAPSIYALSQNPDLARQRQQEVLKKLVRYDYLNQNAAQH
IVSNVRAIAA

Enzyme Prediction     

No EC number prediction in MGYG000004896_02443.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	58	227	1.2e-60	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.12e-77	67	228	16	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.31e-71	66	233	4	171	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.98e-66	14	239	20	252	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.09e-57	66	239	69	242	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	9.44e-44	66	238	60	231	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS67703.1	1.95e-150	1	250	1	250
ACV56467.1	4.87e-144	1	250	1	250
APO31194.1	4.87e-144	1	250	1	250
CBL03605.1	1.80e-120	1	241	1	241
BAK43832.1	9.50e-114	18	243	20	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	5.95e-44	66	243	22	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.37e-43	66	243	22	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.30e-34	48	245	41	244	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3VMQ_A	1.96e-34	48	245	58	261	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	3.92e-34	55	245	12	208	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	1.63e-39	66	243	65	242	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	2.64e-38	16	238	20	241	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q07259	1.32e-37	55	228	38	210	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P39793	6.05e-37	55	234	86	266	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
O86088	1.89e-36	61	228	65	232	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997589	0.000720	0.000017	0.000005	0.000003	0.001697

TMHMM  Annotations     

start	end
13	35