CAZyme Information: MGYG000004885_01065

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia
• CAZyme ID: MGYG000004885_01065
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000004885_17|CGC1	42641.52	9.6363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004885	1991431	MAG	Spain	Europe

• Gene Location: Start: 18334; End: 19500 Strand: +

Full Sequence      

MKYFLVAGEASGDLHASHLMQALKAKDPQAEFRFYGGDAMQAVGGRLLCHYRHLAYMGFA
AVIAHLPTILRGLARCKRAIAGWQPDAVILIDYPGFNLKVAKYVRKAGICPVYYYISPKI
WAWKEHRIHQIKRDVTHLFSILPFEVDFFGRKHNYPVTYVGNPTVDEVAGYVERNGRPQP
DGHTIALLPGSRLDEIRDNLSRMLRAAAPLTDKGFRLTVAAAPAVPPGFYDTLIARSGVP
AGHVEVVEGRTYELLSRATAALVTSGTATLETALFRVPQVVCYYIACGRAVRLLRRLFLK
IPFISLVNLVAGRAIVTELVADGMTVDRIRGELEAILPGGARRQAMLDGYEEMAGLLGTP
GAPQHAADGMLRRLHGDRAGKETVKDAD

Enzyme Prediction     

No EC number prediction in MGYG000004885_01065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	3.1e-108	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.28e-111	1	368	2	369	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.12e-101	1	368	2	373	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.71e-78	4	320	2	322	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.96e-65	5	371	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.40e-43	1	327	1	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77942.1	9.77e-139	1	374	1	376
ALJ61154.1	1.20e-138	1	375	1	377
QUT93317.1	1.20e-138	1	375	1	377
QNL40994.1	9.13e-137	1	374	1	376
AKA50816.1	1.25e-136	1	374	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.63e-36	5	353	11	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.37e-36	5	353	11	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	8.41e-71	2	374	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.84e-61	5	367	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q6ALW0	2.28e-60	5	368	14	380	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
A6V1E5	3.85e-55	1	348	5	353	Lipid-A-disaccharide synthase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=lpxB PE=3 SV=1
Q02RB5	7.60e-55	1	348	5	353	Lipid-A-disaccharide synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004885_01065.