CAZyme Information: MGYG000004883_00110

Basic Information

• Species: Rothia mucilaginosa_B
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa_B
• CAZyme ID: MGYG000004883_00110
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		46067.98	5.7948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004883	2241611	MAG	China	Asia

• Gene Location: Start: 141726; End: 142988 Strand: -

Full Sequence      

MNSQPSSHNEQSLESISEYAQRTSSHAVAAAVSVTDTFVHRILGVPGALIGSVQVPDPRP
LSQRLSIWHYWWQAHLLDCMIDAGQRHLREGDITAAQEELHRARALLRGINVRNYGRFAN
DYFDDMAWLTLAVGRMNSFCIELTGANDVAAQDAGAALFEQLVKGFSPVGGMSWRKSKRD
FVNAAATAPTALAYARAGDPKTAAALMGWMNETLWDAERSLYIDGVNVRGDEYEYERSEF
TYNQGTALGALLSLAASGVPCEVDPAERAERLIVGIVKHMTEEVEFLSGARRRILISHGD
GDGGLFTGILVRYLGMAASSPLLSDEARALASNLVYSTARALWEGRREFDPNLPMNEYGI
DPNEIRGKALVQFSPRFTEPMSKVVKPGAPVELSTQVQAWTIFETAARLAHARDLAAHGF

Enzyme Prediction     

No EC number prediction in MGYG000004883_00110.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	64	351	2.8e-56	0.7513966480446927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	2.94e-43	27	407	3	368	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF62942.1	4.00e-297	1	420	1	420
QXW99112.1	1.15e-296	1	420	1	420
BAS19786.1	3.28e-296	1	420	1	420
BAI65589.1	5.11e-296	1	420	78	497
BAV86349.1	1.17e-151	33	409	31	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	3.99e-27	68	343	86	349	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	9.29e-26	68	343	87	350	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	6.02e-25	68	343	87	350	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	5.45e-15	67	347	42	303	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004883_00110.