CAZyme Information: MGYG000004880_01554

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004880_01554
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000004880_15|CGC1	37078.19	8.6393

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004880	2890596	MAG	Spain	Europe

• Gene Location: Start: 25940; End: 26920 Strand: +

Full Sequence      

MKRRIFIMLTAIMAAAASATAASKYDNPDTLVVARDGTGEFRTIDEAIEVCRAFMEYHKV
IYVKKGIYKEKLIIPQWLTNIEILGEDRDNTVITYDDHANIKSAERPKGIGTFRTYTVKV
EGSRITFRNITIENNSARLGQAVALHTEGDRLVFVNCRLLGHQDTIYTGVAGTRILFKDC
YIEGTTDFIFGPSTAWFENCTIHSKANSYITAASTPADVPFGYVFNNCRLTAAEGITKVY
LGRPWRDYGYTLFMNCDLGGHIRPEGWHHWQKERENTARYMEYNNRGEGSKTDKRVGWSR
QLTKKEAAKITMEEVFGLKDSWKPAF

Enzyme Prediction     

No EC number prediction in MGYG000004880_01554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	315	7.9e-103	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	8.07e-82	32	311	3	290	Pectinesterase.
PLN02773	PLN02773	1.31e-75	31	312	7	292	pectinesterase
COG4677	PemB	1.46e-64	28	316	80	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02197	PLN02197	1.48e-63	30	310	276	562	pectinesterase
PLN02432	PLN02432	3.45e-63	31	322	13	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	4.62e-184	7	324	5	322
ADE82952.1	4.62e-184	7	324	5	322
BCS84477.1	7.03e-168	3	325	2	324
QJR97878.1	1.10e-167	13	324	4	318
AGB28242.1	5.07e-158	6	325	5	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.11e-43	31	298	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.74e-40	32	298	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	2.37e-39	31	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.28e-38	31	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	2.82e-31	41	324	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	6.84e-53	33	307	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	3.48e-52	30	310	272	558	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
O80722	2.69e-51	32	300	278	554	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1
Q5MFV6	5.22e-51	30	310	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q5MFV8	8.06e-51	30	298	283	559	Pectinesterase 5 OS=Arabidopsis thaliana OX=3702 GN=PME5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000522	0.998659	0.000186	0.000242	0.000190	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004880_01554.