CAZyme Information: MGYG000004879_00326

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_N
• CAZyme ID: MGYG000004879_00326
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46708.08	4.1928

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004879	3926800	MAG	China	Asia

• Gene Location: Start: 52943; End: 54202 Strand: -

Full Sequence      

MSFSYVHTLEVPANSVDKGSMQVSVISKETNEPIPDARVTISFSGDPENIVDQLTTDSNG
QTETISLPTPPLEYSQEPNINQPYSEYTVSVSADGFQPFNVSGSQVLALETALQSISLNP
ETASNIVVPAHTLYGNFPPKIAEAEIKPVNEPGEIVLSRVVVPEFVVVHDGVPTDTTAAN
YYERYRDYIKNVASSEIYSTWPENTIRANILAIMSFTLNRVYTEWYRNQGYNFTITSSTA
FDHKYVNGRNIFENISVLVDEIFTNYLSRPNVKQPILTQYCDGNRVSCPNWLSQWGSKTL
GDQNYTPIQILQYYYGDTIYINTAEEIEGIPSSWPGADLDIGSSGQKVRQIQEELNTISE
TYTAIPSVVPDGIFGEATAEAVRAFQKIFKLPQTGIIDYPTWYKISDIYVRVSGIAELV

Enzyme Prediction     

No EC number prediction in MGYG000004879_00326.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	8.26e-14	344	405	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	7.50e-10	341	405	41	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
pfam13620	CarboxypepD_reg	1.66e-05	29	118	9	81	Carboxypeptidase regulatory-like domain.
COG3409	PGRP	1.12e-04	335	405	117	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	0.002	177	315	106	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX92999.1	8.88e-205	19	419	11	416
ANU48790.1	2.54e-204	19	419	11	416
QQR02302.1	2.54e-204	19	419	11	416
ASN94441.1	7.26e-204	19	419	11	416
QRP40879.1	7.26e-204	19	419	11	416

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004879_00326.