CAZyme Information: MGYG000004869_00782

Basic Information

• Species: Lactonifactor sp009677585
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lactonifactor; Lactonifactor sp009677585
• CAZyme ID: MGYG000004869_00782
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		45896.92	4.1238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004869	4923116	Isolate	United States	North America

• Gene Location: Start: 243062; End: 244318 Strand: -

Full Sequence      

MNGTKKRYLCHLLTASMVLAAPVSVLGAESPAQTLLSPYQVSLPSPLMPDSGTETAPGTN
GWTKEGDSWYYYINDEKKTGWQKINEIWYYLEDTGAMAEGWTLIDDTWYYFTPGNGSMAT
GWQFIDNSWYCLDADGAWNENPEINTSGGWSFHDGYWYYNNLNGSPIKGWLKVDNKQYFF
DETGRMTTGWLTLDGKRYYLGEDGVMVTGEQVIDGSNYTFSTAGVCSQEVTSYESNVDAA
SGMYIIEGATSVSVDQMANYFKANAASYPSAVLANGGAPDIETFCEIIYEEAAAENIKAE
VVFTQIMKETGWLNYSGDVSIGQYNFAGLGATGGGVPGVAFSDVRTGLRAQIQHLKAYAS
TAALNQPCVDPRFNYVTRNTSPYVEWLGIPDNPYGGGWAAGQNYGSSLIKMIQDLKSM

Enzyme Prediction     

No EC number prediction in MGYG000004869_00782.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	286	414	2e-17	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	1.50e-40	28	218	423	593	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	8.88e-39	61	215	464	609	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	8.91e-38	44	223	473	640	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	1.51e-34	78	224	485	622	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	1.92e-32	78	224	442	579	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL19417.1	2.92e-71	234	416	45	227
QCU04040.1	4.12e-71	234	416	45	227
CBL26238.1	4.56e-71	234	418	70	256
QRT51288.1	5.96e-68	242	416	79	253
QMW77434.1	9.61e-68	238	418	914	1094

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	2.34e-18	281	415	68	195	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000523	0.998677	0.000225	0.000232	0.000177	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004869_00782.