CAZyme Information: MGYG000004867_00737

Basic Information

• Species: HGM11616 sp900761075
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Christensenellaceae; HGM11616; HGM11616 sp900761075
• CAZyme ID: MGYG000004867_00737
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		21409.23	4.459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004867	2137430	MAG	China	Asia

• Gene Location: Start: 11834; End: 12403 Strand: -

Full Sequence      

MTAKMQKKQKSLLILFFIVLSILLIIVGGYYAIKTLYPLDYVSTIQKYSEENDLDPYFTC
AVIDTESGFDTSAVSRVGATGLMQLMPDTAKWIAGKLGEEYSEDSLTNPETNIKYGTWYL
RYLLDKYNGDETSAIAAYNAGHSNVDEWKDKIPDGDSISTEDIPFEETKNYVKKVSFAHD
VYQKLYPNL

Enzyme Prediction     

No EC number prediction in MGYG000004867_00737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	175	5.9e-32	0.7555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.12e-75	38	181	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.69e-65	36	185	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.50e-45	61	175	6	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.53e-42	20	186	118	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	5.40e-35	45	149	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ07016.1	1.79e-52	30	187	23	179
BCS81120.1	1.79e-52	30	187	23	179
ADQ40926.1	5.08e-52	30	187	23	179
ADQ04776.1	2.05e-51	30	187	23	179
ADL42414.1	2.05e-51	30	187	23	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.86e-24	34	186	405	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.88e-24	34	186	409	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.90e-24	34	186	415	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.92e-24	34	186	419	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.94e-24	34	186	425	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.61e-24	43	179	62	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	5.14e-19	41	175	1422	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	5.14e-19	41	175	1422	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P39434	1.11e-18	37	184	476	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	3.78e-18	37	186	476	628	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985680	0.012778	0.000311	0.000102	0.000050	0.001108

TMHMM  Annotations     

start	end
12	33