CAZyme Information: MGYG000004860_01496

Basic Information

• Species: Levilactobacillus namurensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Levilactobacillus; Levilactobacillus namurensis
• CAZyme ID: MGYG000004860_01496
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40488.24	9.6713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004860	2610545	MAG	China	Asia

• Gene Location: Start: 22802; End: 23884 Strand: -

Full Sequence      

MKKWLTDILQGPTFDATRQAKADIATIGQAAGYHIIDIRRYGGLKESNEALMARIQGATA
GVSQGDLLVYQYPSLNDGRYEDFFIRQMHRRGVRVVALIHDIETLRDQHAPRWIHEFAFF
NQCDVLIVHSERMTAYLRQQGVTTPVVYQYLLDYLDDGATGVRHAIQPQDFQRRVVLAGN
LQKSQYLGDWSAQTPITVFGAANPQLTRALMANPQVDYRGSRVRRQLLRELPPTFGLAWD
GNTATYRYSSYTRYNHPHKVSMYLSHGLPVIVWKEAAVADLIVRNHLGLAIDSLDQLDQA
IQQLSATDLATMLANVAQVGQLIRSGWFTRQALVAAEAKVLAPKFTLQATGPLSQKVLSR

Enzyme Prediction     

No EC number prediction in MGYG000004860_01496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	14	336	1.9e-92	0.968944099378882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	5.20e-103	1	340	1	333	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMS13283.1	3.02e-160	1	345	1	345
QFR61652.1	3.02e-160	1	345	1	345
SMS15368.1	3.43e-157	1	349	1	349
QFR62055.1	3.43e-157	1	349	1	349
QMU08517.1	1.13e-155	1	347	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	1.83e-31	1	336	3	325	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	5.74e-26	1	333	3	322	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	6.41e-26	1	333	11	330	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3XPQ7	7.16e-35	9	336	8	328	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	5.95e-33	9	340	13	337	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
A0A0H2UR93	7.65e-33	1	336	1	329	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	5.30e-31	20	342	20	334	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
A0A0M3KKZ0	9.65e-31	1	336	1	323	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004860_01496.