CAZyme Information: MGYG000004859_00470

Basic Information

• Species: Collinsella sp008014645
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp008014645
• CAZyme ID: MGYG000004859_00470
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654		71789.75	8.4121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004859	1758189	MAG	China	Asia

• Gene Location: Start: 9155; End: 11119 Strand: +

Full Sequence      

MTISKKMHILFASAEAAPFVKTGGLGDVAGSLPAALNQAGAETIVMVPRYNTIPQKFKDQ
MEFITSFYVSLGWRNEYCGLLRLVHNGVTYMFIDNQRYFGRDYPYGFFDDGERFAFFSKA
ICESIQHLPDGFAPDILHCNDWHTALAPVFLREFYQGLPLYENIKTVFSIHNIAFQGQFS
AKVLEDICGMAHIPAAAFQLTCGPDAVNYMQGALNYTDAITTVSPTYAGEIQTPAYGENL
DGVLRRRRESLQGIVNGIDVDHFNPETDPAIAQNYSVSDRTGKAVCKRALQEELGLTVRT
DQPLMTMVTRLTRQKGMDLVTYSLDRILSNGVQVAVLGTGDQEYENALRYFASKYPGQMA
ACIQFDPALSQRMYAGSDLFLMPGLFEPCGLSQMIAMRYGTLPVVRETGGLKDTVIPYNF
VTGEGTGFSFANFNGDEMGDAVFRGARLFWDNRDAWDQLVTQAMEQDFSWKRSAGKYMDL
YYWLHPDVPHWVEQPVVEPEPAVEPAHETAQADKPMKKPATKKTAARKTAATKRSATTKR
ATKAAATAEAVDTAAENETKTAAKPAAKRTTTRKAVTTKKVAAAAEPAAEPEVKPAVPKT
TARKTTVRAKTAAPDTTSAAPAGTTTVETVDPKVAAAKPAAKKVPTARKTAKRR

Enzyme Prediction     

No EC number prediction in MGYG000004859_00470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	8	482	6.6e-179	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	8	483	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	0.0	7	484	1	478	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	0.0	7	484	1	463	glycogen synthase GlgA.
TIGR02095	glgA	0.0	7	482	1	471	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	3.17e-128	7	481	4	476	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70577.1	1.01e-276	7	522	1	533
QIA34705.1	2.04e-276	7	488	1	482
ATP54860.1	3.21e-276	7	488	1	482
QWT18297.1	1.02e-256	7	487	1	481
AEB07181.1	1.37e-250	4	481	3	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	1.64e-94	7	481	1	472	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
3D1J_A	1.26e-90	7	484	1	476	ChainA, Glycogen synthase [Escherichia coli]
1RZV_A	3.11e-90	8	481	2	472	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
2QZS_A	8.60e-90	7	484	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
4HLN_A	3.91e-89	9	490	127	631	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6M334	1.68e-167	7	481	1	472	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
A3CM04	9.80e-166	7	481	1	472	Glycogen synthase OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=glgA PE=3 SV=1
A8AYH0	8.96e-164	7	481	1	472	Glycogen synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=glgA PE=3 SV=1
A0PY73	4.52e-162	7	481	1	472	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
B9DWP3	3.60e-160	7	481	1	471	Glycogen synthase OS=Clostridium kluyveri (strain NBRC 12016) OX=583346 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997519	0.002509	0.000003	0.000002	0.000002	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004859_00470.