CAZyme Information: MGYG000004853_01941

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004853_01941
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
195		21312.05	10.6302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004853	1935480	MAG	China	Asia

• Gene Location: Start: 4; End: 591 Strand: +

Full Sequence      

MMQAASRFPECQIIVGGSSSIPMKYYRQVAQTQGLNVVFGATHVLMKHARAALVTSGTAT
LETALLGTPQVVCYRANGRKLSYKIMEKLLKVKYVSLPNLIVGNAVVPELLVHLCTADSI
ARHLSPLLQGSPERDAQLAGYRKMRWRLGSAIATDYAATLICGSLGLNIPLEILRPQTQP
ASRPKRKKTQTRPSE

Enzyme Prediction     

No EC number prediction in MGYG000004853_01941.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	2	146	1.8e-36	0.4096045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.26e-38	1	148	207	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.93e-35	40	161	256	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.84e-24	3	145	212	356	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	5.37e-12	42	120	229	309	lipid-A-disaccharide synthase.
PRK01021	lpxB	0.002	45	111	485	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08529.1	3.98e-47	1	161	211	370
ASB37800.1	3.98e-47	1	161	211	370
ANU64105.1	3.98e-47	1	161	211	370
QCD36425.1	5.73e-44	1	161	211	370
BCI64292.1	2.22e-42	1	165	210	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.15e-11	28	148	247	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.15e-11	28	148	247	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02AZ6	1.15e-16	13	160	222	367	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q9HXY8	1.56e-16	35	145	251	360	Lipid-A-disaccharide synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=lpxB PE=3 SV=1
Q02RB5	1.56e-16	35	145	251	360	Lipid-A-disaccharide synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=lpxB PE=3 SV=1
B7V7U5	1.56e-16	35	145	251	360	Lipid-A-disaccharide synthase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=lpxB PE=3 SV=1
A6V1E5	2.92e-16	35	145	251	360	Lipid-A-disaccharide synthase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000093	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004853_01941.