CAZyme Information: MGYG000004853_00001

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004853_00001
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000004853_1|CGC1	39775.25	8.2101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004853	1935480	MAG	China	Asia

• Gene Location: Start: 236; End: 1321 Strand: -

Full Sequence      

MKRNLTALCAVLISVLSLSLRCAATDVAPTDPDFAYVGRISVNPQGNVAFTYPGVQIHAL
FTGTSVAMLAKPGSGYFMVEIDDREPFKVESVKTSSVVPLASGLADGAHRLTITFANEGH
TLKPEFCGLRLDEGSGLAGRPELPARKMEFIGNSITCGLGNEGTPADKKFNYSKQNQYYT
YEAIAARELNAQCQVVARSGIGIYRNNNGNVTGDKNSMQGVYPYTFFGMTGEKWDFSKYQ
PDVVCVNLGTNDTTYPRYETSLLAKGFKDFIKTLRGHYPKAKIVLLTGSMLNGQRLKDVQ
QAQIEAIEEARKAGDTEIYRFDFTPDDGSLGWGMFKHPSARRHARMAEELVPFIREITGW
K

Enzyme Prediction     

No EC number prediction in MGYG000004853_00001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	147	354	9.6e-62	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	1.18e-37	147	355	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	2.59e-23	36	138	1	105	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam13472	Lipase_GDSL_2	1.86e-11	150	341	1	172	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01833	XynB_like	6.87e-10	237	348	37	151	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd00229	SGNH_hydrolase	3.94e-09	150	353	3	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12079.1	8.87e-128	10	361	8	369
ADY36201.1	5.23e-109	31	360	40	369
ADE83543.1	7.87e-105	27	360	30	375
QVJ79798.1	2.23e-104	27	360	30	375
QNT66876.1	1.73e-94	27	360	36	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	1.37e-59	31	360	8	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	3.81e-59	31	360	8	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	2.34e-37	19	360	5	339	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
2W9X_A	6.67e-22	38	359	34	358	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]
4XVH_A	2.02e-21	36	360	4	329	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	3.22e-55	31	360	489	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	1.61e-36	19	360	24	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1
B3PDE5	3.41e-21	38	359	34	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000512	0.491492	0.507438	0.000200	0.000182	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004853_00001.