CAZyme Information: MGYG000004813_01565

Basic Information

• Species: Proteus sp003144505
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus sp003144505
• CAZyme ID: MGYG000004813_01565
• CAZy Family: GH103
• CAZyme Description: Tn3 family transposase TnXax1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		32748.01	5.0202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004813	3063039	MAG	China	Asia

• Gene Location: Start: 3730; End: 4611 Strand: -

Full Sequence      

MGYKQETIDFAFSEAHFIERVIKSDRNQPEKKITLDVYLPRIVTNGRLNQGAKLYQENQD
TLEQISKKYGVPANYIVALWGLESGFGKVQGKEDVVSALATLAFEGRREELFARQLMAAL
EIIEEGHIPQGQRLKGSWAGAMGQTQFMPSSFLTYAADGNGDGKIDIWNTQEDAFASAAN
YLATEGWKSGLPWGEQVTLSVDFNQQLEGIKTEQKKTVAQWKALGVQLPVNSQLNDAMTV
WLIIPDDDLHRSYLVTQNFRTIMHWNSSYFFALSIVTMADGVANKINSLPNAS

Enzyme Prediction     

No EC number prediction in MGYG000004813_01565.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	2	282	1.2e-107	0.9423728813559322

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	5.29e-135	2	280	17	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02283	MltB_2	4.39e-122	2	283	17	299	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	1.06e-107	2	283	56	336	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	3.56e-42	38	283	115	354	murein hydrolase B; Provisional
cd13399	Slt35-like	1.22e-24	69	199	1	86	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHN10764.1	1.11e-213	1	293	83	375
QKJ48321.1	5.27e-212	1	293	83	375
QQP25675.1	3.04e-211	1	293	83	375
QPB79668.1	3.04e-211	1	293	83	375
QIG06025.1	6.14e-211	1	293	83	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ANZ_A	4.58e-60	2	280	63	341	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]
5AO8_A	4.58e-60	2	280	63	341	CrystalStructure of SltB3 from Pseudomonas aeruginosa in complex with NAG-NAM-pentapeptide [Pseudomonas aeruginosa]
5O8X_A	6.25e-33	2	283	20	300	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	8.83e-33	2	283	37	317	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	1.23e-30	38	283	76	315	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	1.39e-29	38	283	117	356	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004813_01565.