CAZyme Information: MGYG000004812_01563

Basic Information

• Species: UBA1822 sp002314995
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822; UBA1822 sp002314995
• CAZyme ID: MGYG000004812_01563
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237		27064.4	4.7207

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004812	1918692	MAG	China	Asia

• Gene Location: Start: 29; End: 742 Strand: +

Full Sequence      

MVHRGADVEYSVPEGISVLMYHMIGSEPNNDAIMSAANLRRQMEYLRDNGYHPITMQELA
DYVTKQAPLPSKPVCITFDDGYEDNYTIVYPMMKEFGFPWTVFVITGDVGKTNRMTWEQL
NEMADSHAVTIASHTVTHPKLHNLPPEEVRAEIEGAQKALKEHLGIDNPWIAYPYGDYDE
TVDEIAREAGIRLAVTTDSGRVHAGSYPYELRRVWIGNQVDEAHFRERLTRDDYTII

Enzyme Prediction     

No EC number prediction in MGYG000004812_01563.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	66	196	4.2e-39	0.9538461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	2.92e-67	73	218	1	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	8.24e-48	39	214	4	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10973	CE4_DAC_u4_5s	1.01e-43	72	213	1	150	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10968	CE4_Mlr8448_like_5s	8.33e-40	74	214	3	156	Putative catalytic NodB homology domain of Mesorhizobium loti Mlr8448 protein and its bacterial homologs. This family contains Mesorhizobium loti Mlr8448 protein and its bacterial homologs. Although their biochemical properties are yet to be determined, members in this subfamily contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10966	CE4_yadE_5s	9.42e-40	70	216	1	155	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX52714.1	2.75e-53	14	231	37	270
AQS60291.1	7.36e-50	3	229	32	273
ABO51554.1	5.02e-48	7	229	39	276
AEG61805.1	1.74e-47	6	229	33	271
ADY56017.1	5.48e-43	11	234	78	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WCJ_A	1.65e-26	14	209	35	242	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
6DQ3_A	8.97e-25	13	216	6	215	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
5BU6_A	1.63e-24	44	223	48	270	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]
3VUS_A	1.05e-18	15	229	7	264	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4HD5_A	5.52e-18	16	214	144	341	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	2.34e-36	13	225	62	271	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P31666	1.44e-23	15	216	169	390	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
P75906	3.33e-17	15	229	48	305	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	4.52e-17	15	229	48	305	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1
Q8NUI6	3.25e-14	20	222	63	277	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004812_01563.