CAZyme Information: MGYG000004808_00719

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B
• CAZyme ID: MGYG000004808_00719
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		33057.18	5.2063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004808	1820324	MAG	China	Asia

• Gene Location: Start: 6119; End: 7027 Strand: -

Full Sequence      

MGDHRYIWHTPAVLHFGDWVAPDVPKMGQWQARSKWTATASLQHTSGPVACIAEVLGEKD
DAEKYGRLSERVARAYRNVFTDGHGRLKQEFQTAYVLPIQFGMLKGDELRAAVARLAELV
AQGGYRIGTGFPGTPYILFALADNGEKDAAFRMLECTDCPSWLYEVVHGATTIWERWDGL
DENGNCPIGDDGTDIMISYNHYASGAVGDFLYRRVAGLEALEPGYRRSRVQPLVGGGLRS
ARGAVETPYGRLASSWKLDGTAFSLEVEVPLGTTCEVVLPDGATHEVGCGTYTFSCEVEG
AR

Enzyme Prediction     

No EC number prediction in MGYG000004808_00719.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	7	279	3.5e-73	0.5119047619047619

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.24e-55	15	215	149	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.40e-22	217	294	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFJ54533.1	2.82e-134	2	298	464	760
QRT30386.1	3.70e-106	2	293	554	843
QEI31654.1	3.70e-106	2	293	554	843
QHB24153.1	3.70e-106	2	293	554	843
QNO38777.1	1.07e-103	3	296	549	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	2.06e-49	12	294	574	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	4.08e-45	16	301	744	1035	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	6.41e-26	16	280	610	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	3.16e-45	16	280	618	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	5.58e-44	16	295	744	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	3.20e-35	12	280	610	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004808_00719.