CAZyme Information: MGYG000004789_01400

Basic Information

• Species: Streptococcus sp001556435
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp001556435
• CAZyme ID: MGYG000004789_01400
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194	MGYG000004789_42|CGC1	21976.12	9.6813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004789	2137490	MAG	China	Asia

• Gene Location: Start: 7563; End: 8147 Strand: -

Full Sequence      

MRRRFKLKAFITLVAVFALGIVLPLILHVSTDDNARSVKVAYTQQEFIETLAPTAQKMSK
NYGVPASILLSQAAYESNYGSSLLSVKYHNIYSLAAQPGQERIRLKDSIYSKGKWQYQKV
DFAVFKDWSSSMMTYLEELRQGTWGESTYKEVAGTTSYKVAAEKLQAAGFSSDPDYAKHL
ISIIETYHLSKYDR

Enzyme Prediction     

No EC number prediction in MGYG000004789_01400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	189	4.2e-26	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.27e-43	1	194	1	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	6.23e-22	38	193	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	1.03e-17	29	193	303	472	amidase domain-containing protein.
PRK06347	PRK06347	1.60e-14	43	193	149	303	1,4-beta-N-acetylmuramoylhydrolase.
NF038016	sporang_Gsm	2.26e-14	43	193	159	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC33555.1	1.86e-134	1	194	1	194
ARC48648.1	3.09e-133	1	194	1	194
QGU79769.1	3.09e-133	1	194	1	194
AIY20374.1	8.21e-131	1	193	1	193
AMB81973.1	8.21e-131	1	193	1	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	9.76e-15	44	193	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	6.81e-10	45	184	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.89e-10	45	184	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5T1Q_A	1.02e-08	29	193	43	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.73e-08	45	185	4	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.39e-21	4	193	3	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	2.32e-13	45	193	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	1.46e-12	43	193	61	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.98e-12	43	193	61	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	2.27e-12	3	193	19	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999922	0.000067	0.000004	0.000000	0.000000	0.000037

TMHMM  Annotations     

start	end
7	29