CAZyme Information: MGYG000004770_00871

Basic Information

• Species: Streptococcus sobrinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sobrinus
• CAZyme ID: MGYG000004770_00871
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		33516.64	7.1427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004770	2052412	MAG	China	Asia

• Gene Location: Start: 22008; End: 22919 Strand: -

Full Sequence      

MTSRNQKPGRSSHTSRNLLAIIGLVFIIGAFAFMFKNHSFSPSQLLKSEKTSQTSKKTNQ
GQTSQSDKKAKVDWKKQDETVKVPILMYHAIHVMDPSESASANLIVSPDTFESHIKALKE
QGYYFLTPQEAYKVLSENVLPNGNKKIVWLTFDDGDADFVNAATIMKKYGAVGTNNIITS
YTDKDGFLTSDKIKELAKEGMSFQSHTVNHPDLSTQSDDSQNTEIGESKSWLDRLLGQDT
IALAYPSGRYNDSSQKLAEQAGYKMAVTTNEGLASADNGLYALNRVRILPTTTADDLINT
IAW

Enzyme Prediction     

No EC number prediction in MGYG000004770_00871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	144	269	5e-26	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	8.55e-53	148	288	2	154	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	4.50e-35	108	286	1	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
COG0726	CDA1	4.35e-31	84	267	2	184	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam01522	Polysacc_deac_1	8.33e-31	142	266	3	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10970	CE4_DAC_u1_6s	7.63e-30	147	303	2	160	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY32711.1	3.68e-48	74	290	56	264
QNM15969.1	1.59e-27	83	293	352	574
ADY56017.1	4.34e-27	83	301	86	297
QYR62058.1	5.75e-26	83	293	13	232
QBC26902.1	1.25e-25	85	302	9	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	1.43e-84	81	301	7	228	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
6GO1_A	4.08e-26	83	301	100	317	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	3.11e-47	74	290	56	264	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q5HKP8	9.12e-14	86	288	47	270	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaB PE=3 SV=1
Q6TYB1	9.12e-14	86	288	47	270	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis OX=1282 GN=icaB PE=1 SV=2
P31666	4.52e-09	85	302	172	404	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
Q81AF4	8.48e-09	140	264	17	137	Peptidoglycan-N-acetylglucosamine deacetylase BC_3618 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=BC_3618 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35