CAZyme Information: MGYG000004759_01108

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella
• CAZyme ID: MGYG000004759_01108
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000004759_51|CGC1	43412.06	6.7751

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004759	2383712	MAG	China	Asia

• Gene Location: Start: 7096; End: 8238 Strand: +

Full Sequence      

MKYYLIAGEASGDLHGGQLMKALKEHDSAAEFRYFGGDEMQGQGGTLVRHYKDTAYMGFI
PVLLHLRQIFRNMDLCKQDIVKWQPDVVILIDYPGFNLSVAEYLKKNTTIPVYYYIAPKI
WAWKEHRIKNIRRDVDELFSILPFEIEFFEQKHHYPIHYVGNPSLDEVHEFLAQHPDDPE
GFRKEYGLDDRPIIALLAGSRKQEIKDNLPMMAQVALEHAADYQIVLAGAPNIDLSYYRQ
YINEGQIRILTGCTYRILQHSAVALVTSGTATLETALFRVPQVVCYYTACGKLVSQLRKL
FLKVPFVSLVNLITGDEVVPELVADQMNPERLRRELQGILPGGAQREAQLAGYQRMLSRL
GEPGAPDRAAREMIQLLRKE

Enzyme Prediction     

No EC number prediction in MGYG000004759_01108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	2.5e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.08e-106	1	380	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.64e-100	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.39e-74	4	370	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.60e-59	5	376	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.19e-47	1	332	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69124.1	3.22e-176	1	379	1	378
QUT93317.1	5.65e-176	1	377	1	376
ALJ61154.1	1.14e-175	1	377	1	376
QUT32803.1	1.75e-173	1	379	1	378
QDH54418.1	2.49e-173	1	379	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.12e-38	5	376	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	9.89e-38	5	376	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.76e-67	5	377	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.66e-64	5	379	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q2IL69	7.13e-59	5	378	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q02AZ6	9.52e-59	2	377	3	373	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
B4UHR6	1.00e-58	5	378	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004759_01108.