CAZyme Information: MGYG000004748_00515

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004748_00515
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	MGYG000004748_2|CGC5	97065.87	5.9127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004748	4696076	MAG	China	Asia

• Gene Location: Start: 170753; End: 173296 Strand: +

Full Sequence      

MMKIRNILSSLLWMILFLPVSSIWAADGFVAFNSQDAQFALVTPQSKAFAVWCDKTEHKG
VLTAVQNLQTDFEKVTTVRPVMVHNLGKEVRIIVGSYDKSPLVRQLMKAGKLDAGLLKDK
NEKFIITTLHAPLKGLEGEILLIAGSDKRGTIYGVYELSRQMGVSPWYWWADVPVSHQDA
IYIKEGIYTDGEPAVKYRGIFINDEWPCMGGWTTEKFGGFNSKMYVHMYELLLRLKANFL
WPAMWNAAFYVDDPMNSPLADEMGIIIGTSHHEPMARNHQEYVRNREAYGAWNYQTNKEN
INRFFREGIERMKGKEEVVTIAMRGDGDAPMGPDTDTRLLENIVKEQRKIIADVTGKPAK
QTPQLWALYSEVLEYYDKGMKIPEDVMILLCDDNWGDVRRLPDLNDKKHPGGYGMYYHVD
LHGAPRAYQWLNMTQIQHMWEQLYLTYTYGVDKMWILNVGDLKPNEFPTDFFLNMAWNPE
RFNADNLLDYTRDFCKQQLGDKYAVEAARILNLYCKYAARVTAEMLDSHTYNLSSGEFKA
VTDEFLALEAYAYRQFLTLPENLKDTYKELILFPIQAMANLYEMYYAVAMNRQLASEGNP
RANDWADRVEYCFKRDAELCDDYNHNIAGGKWNHMMDQTHIGYTTWDEPKEGNVIPQVNR
VDASAYIPGGYEYEETGGVVVMEAERFAESRQSSNTHWTVIRDLGRTLSGVALMPYTLPV
DSASLTYRMNLKSEMKDLRLRLILDSTLPFVKGGHSYAVSLDGGKEQIINYNSEMTWANC
YTKMYPAGAARIIESVVDFPDVNLKEGKHTLRIRPLVPAIVLHKIIVDCGGDGQGRLNLH
ESPYRKE

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	44	825	5.1e-270	0.9885222381635581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	191	525	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.86e-33	675	831	4	162	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	6.19e-07	40	158	12	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDO10801.1	0.0	8	846	6	844
QRQ55179.1	0.0	8	846	6	844
SCV07743.1	0.0	8	846	6	844
ALJ48335.1	0.0	8	846	3	841
QUT78599.1	0.0	8	846	3	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	12	847	15	854	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	1.89e-302	54	846	31	838	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.70e-300	54	846	30	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	9.06e-178	54	661	28	634	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	8.64e-130	92	655	65	654	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000295	0.999079	0.000157	0.000151	0.000138	0.000136

TMHMM  Annotations     

start	end
7	26