CAZyme Information: MGYG000004744_01881

Basic Information

• Species: Megamonas sp900556715
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas sp900556715
• CAZyme ID: MGYG000004744_01881
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		50834.22	9.1808

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004744	2057636	MAG	Denmark	Europe

• Gene Location: Start: 91; End: 1410 Strand: -

Full Sequence      

MYSRKVGLLASAILATSCLNLIVASINILDMALTLFMTACMVFFYAFERTEKKKWLIAFY
IAMGFGVLTKGLVAIILPFGILFWYTILTKRPRLFLKLFYLPGILAFLIVTVPWFYLVCQ
ANHDFFYFFFVREHFLRFTTKMHDRFQPWWFFIPFVIIGMLPWTGFLLSLFSKKGVIRKT
TSQRNRFDIIFLLLWFFIIFIFYSISDSKLVPYIMPCWMPLAILIAASIKRFEDENSWLC
HSFLINSILCLAFVGALVGYVLSSNYLTIDEFIAEGGLLTATLFIGTIASIFVWIKTKRF
RCTVSVLCIMGFFFGLGLHDVQEQVHNNQSAYYVSQKINELNPQDALIVNYGDFYHGIPY
YTNQRVALADFKGELEFGSEHPSGAGWFFNGEELNNLWNSQKRIIIVVKERYKDKCLNVL
TSPAKQVITEGSYTILINK

Enzyme Prediction     

No EC number prediction in MGYG000004744_01881.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	413	2.4e-83	0.7666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	1.06e-39	4	437	110	549	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	4.51e-30	1	403	108	522	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	8.33e-09	2	110	47	154	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.62e-07	2	123	109	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam18583	Arnt_C	0.004	356	414	23	81	Aminoarabinose transferase C-terminal domain. ArnT is a member of the GT-C family of glycosyltransferases, and it has a similar fold to a bacterial oligosaccharyltransferase (OST) from Campylobacter lari (PglB) and to an archaeal OST from Archaeoglobus fulgidus (AglB). This entry represents the C-terminal periplasmic domain of Arnt proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA10995.1	1.84e-317	1	439	111	549
QIB60981.1	3.60e-316	1	439	111	549
SNV04445.1	6.29e-280	1	439	111	549
AXB81287.1	1.29e-173	1	439	111	550
AVO73572.1	6.88e-171	1	439	111	550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	8.65e-33	22	379	153	514	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4EUL1	3.85e-35	10	436	119	545	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
A0KGY4	1.51e-30	4	386	107	490	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	1.51e-30	4	437	107	542	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
Q8D339	1.45e-29	1	419	115	543	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Wigglesworthia glossinidia brevipalpis OX=36870 GN=arnT PE=3 SV=1
C5BDQ8	2.87e-28	7	436	112	546	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.981220	0.000335	0.018420	0.000000	0.000000	0.000038

TMHMM  Annotations     

start	end
7	29
55	88
95	117
146	168
189	206
210	229
241	263
273	295
302	319