CAZyme Information: MGYG000004701_01618

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004701_01618
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		40205.74	8.883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004701	2483824	MAG	China	Asia

• Gene Location: Start: 83; End: 1207 Strand: -

Full Sequence      

MKTSSLLLVLALVGVLGGGCGASSGPVDDVAAPGTMLTEPPSGTTPGGDDVRGRDLPGVN
VDPAVLRKSAPATTPPAATPPVRTTSQTAAPVQATASARPWDELARRLAADGVSGPQVDA
LLATLPSVPTQSPMGRKINALYQRRFFPKPPSTAPAARYYKGVLTEANAQACRDFLAAHA
AAFDVAEQRYQVPRSIAVSLLFVETRLGKVLADVKENAFYTLASMAVTRTPESISGWLPR
MKDYEKHRDWFEQTMPRRADWAYKETRALVVYMTREGISPDQLPSSVYGAVGLCQFMPSN
IDVYGADGNGDGRVNLFEIPDAVASLANYLYRHGWRTGIDRARQHKILMAYNHSSVYANT
ILALSDMVEGRAVS

Enzyme Prediction     

No EC number prediction in MGYG000004701_01618.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	103	344	8.5e-46	0.6847457627118644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	1.35e-48	97	367	1	233	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
COG2951	MltB	2.58e-29	86	338	28	244	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	9.18e-26	148	338	102	266	murein hydrolase B; Provisional
cd13399	Slt35-like	3.45e-24	277	366	17	107	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	0.005	289	352	23	79	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV73295.1	5.40e-144	8	368	15	362
QCC86237.1	8.66e-136	101	370	127	396
QTO41794.1	4.42e-135	69	370	112	417
AMD89133.1	8.15e-134	96	368	113	385
VZH34730.1	1.25e-127	101	368	104	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LTM_A	1.98e-16	149	338	64	227	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	2.02e-16	149	338	66	229	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5O8X_A	3.13e-16	174	338	71	208	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	3.75e-16	174	338	88	225	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5ANZ_A	2.66e-09	149	338	89	250	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	1.57e-15	149	338	105	268	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000011	1.000037	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27