CAZyme Information: MGYG000004701_01375

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004701_01375
• CAZy Family: GH102
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000004701_172|CGC1	37619.84	9.93

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004701	2483824	MAG	China	Asia

• Gene Location: Start: 157; End: 1164 Strand: -

Full Sequence      

MESPEFFAQRLAPQNQELTSWTDLAPSLRKSLAYVKSKPADAVAVSRPGLRVTWGELRRT
LEELRALLPRLDADPTLLLQRFRWVAVPGGINYSGYYEPVVRASRTRKPGYEHPIYKRPP
DLSRVRARRGRYYDRRTIETKGVLAGKDLELAWAADPVDVFFLEIQGSGRLLFDDGTQAF
VNYDGQNGHKYKSSGRIMREKGLLKRGDIFEQREWFKNNPDRVWEILLENPSYVFFKFGG
RGPTGAMGQVVDGWVSLATDRGYIPLGAVVAYGVNAPDQTYGSVPLRGIGLAQDVGGAIK
SRRIDIFCGGDERANYVASHLDAKGPAWVLLLKDQ

Enzyme Prediction     

No EC number prediction in MGYG000004701_01375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	101	237	1.6e-41	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2821	MltA	1.28e-68	95	333	127	366	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
pfam03562	MltA	3.34e-68	21	237	1	231	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	2.51e-59	101	238	1	158	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	1.91e-58	100	237	1	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	4.97e-46	89	330	114	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD90327.1	8.32e-197	2	333	73	404
QTO41166.1	3.32e-193	2	333	60	391
QCC85116.1	9.85e-193	2	333	61	392
ATD81892.1	3.19e-190	2	333	27	358
SPD34632.1	3.19e-190	2	333	27	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESJ_A	3.42e-39	94	330	103	357	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
2AE0_X	1.26e-36	89	330	94	333	Crystalstructure of MltA from Escherichia coli reveals a unique lytic transglycosylase fold [Escherichia coli]
2GAE_A	1.79e-36	89	330	95	334	Crystalstructure of MltA from E. coli [Escherichia coli]
6QK4_B	3.62e-36	94	330	104	344	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
2PJJ_A	1.80e-35	89	330	94	333	ChainA, Membrane-bound lytic murein transglycosylase A [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	1.43e-35	89	330	114	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	1.43e-35	89	330	114	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q9KPQ4	2.10e-29	37	334	46	353	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
Q8K9A7	1.18e-20	89	330	122	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004701_01375.