CAZyme Information: MGYG000004697_00416

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F
• CAZyme ID: MGYG000004697_00416
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1023		114026.89	6.7249

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004697	2635939	MAG	Spain	Europe

• Gene Location: Start: 79281; End: 82352 Strand: +

Full Sequence      

MYQQKCMGKRGLAVALSLILLGGSIGTAVPGVQARKTEKVTVKNPEITSLALKRGEKFQL
KTKGNVIFQSTNKKVITVTKKGMIRAKKAGKASIKIRSKNAKKCNVRLQVRVYGKFTKAK
KVSVKPKQLLLKAGEERKITVSLSPKKATVNKVIWKSSDKKIANVDKTGKITAKKAGNVK
VTAYAADGRGAKAVCSVTVAEKGKEEETTPAVHSTNPEPQPTGSATQNPQTQNPQTKEPQ
PQESDRVVLADETQCLSLYVDGKAKDSEGIQLVAKSFAEDVALVSESGQKPQIITENPKS
EGTMLIAGSVGNNELIDSLAAQGKIDISDISGKRECYRIQVVEQPTEQIERAIVVAGSDK
RGTIYGIYHISELIGVSPWVYWGDAVPEKKSAITLSSADLTVTSKEPSVKYRGIFLNDEA
PSLTGWVKEKFGNYNEDFYELVYQLILRCKGNYLWPAMWSNSFSEDGKQAPEANAELADK
YGIVMGTSHHEPMCRAGVEWQRSYKKYGTSNAWDFTKNQQAITDFWKGGIERNKSYENVY
TLGMRGESDSALGGSVEDNINLLKNVIMTQKNILKENTLSDAPQVLTVYKEVEDYWYGTE
ETAGLKDWSELDDVTIMLCDDNFGNMRTLPTGEDIKRPGGWGMYYHFDYHGGPTSYEWVN
TVELGKVWEQMTMAYEHGIDDIWIVNVGDLKPMEMNISYFLDLAYDYDAWGEKGESKIEQ
YRAQWVRQQFGRSMSEDTVQEITSLLKEYTWLNGSCKPEVLYNGTYSVTNYNEAENVLTR
IQAMIEKAEKVKKEIPASLQAAYYQLVYYPVAASANVGEMQIYSGFNNRYYELGSTAANV
YAKLVKKTIARDKELQDEYNNNMPGAGNKWKNMMSSPHVGYVAWNSEGWSYPEVKYTAPE
GDGAAMLVELENDSNVYSKGKCVLDDFHDISQESQRIRLLCGEGSAFHYEVQTSDDWITV
SKKSGYVTTIDSLDVSIDWSRVSEDKTGTIVIKADDNTVSIAVTAKCHNIQNLEEKTYVY
ANG

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	246	917	2e-222	0.8522238163558106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	405	760	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam02368	Big_2	4.22e-11	122	194	3	75	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
COG5492	YjdB	2.04e-09	117	199	179	261	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
smart00635	BID_2	9.59e-06	120	194	3	80	Bacterial Ig-like domain 2.
cd14948	BACON	3.07e-05	949	1004	28	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEY65938.1	7.46e-307	245	1022	5	777
AIQ35136.1	2.58e-305	249	1022	8	776
AWV33044.1	2.43e-303	249	1019	15	780
AGF58615.1	9.45e-302	247	1019	4	771
AIQ23284.1	2.17e-301	244	1019	3	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	1.30e-198	269	1023	31	792	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	7.67e-168	247	982	14	721	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	2.48e-152	258	885	55	651	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	4.49e-142	245	885	15	636	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.36e-141	245	885	14	635	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.019209	0.943943	0.029433	0.006652	0.000448	0.000293

TMHMM  Annotations     

start	end
12	34