CAZyme Information: MGYG000004687_01628

Basic Information

• Species: Haemophilus_A parahaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_A; Haemophilus_A parahaemolyticus
• CAZyme ID: MGYG000004687_01628
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260	MGYG000004687_29|CGC1	30504.99	9.454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004687	2063107	MAG	China	Asia

• Gene Location: Start: 5561; End: 6343 Strand: +

Full Sequence      

MSIKYEKLIVLCNGLSRLLGNIVKILGYPFHALFPKKRFTIPEFSPAKLSSNRKDKINRT
IWQTNYSNKVTLPMYCNYLFNRLMSLSYDYRYVSTEEREEYLKTHAEPRVFEAYSQLTDG
AAQADFWRVFTLWREGGIYIDIDGHLVFPLSQIIRENDNEVLIKRRDKYTNFFLACEAGH
PIMKATLDRIVDNIENRRIDGGVFVMTGPDTLNAAIGNQIVNTRRDKITCTQGTFTNEHF
QYIDKPRSKWNYKKNEELLK

Enzyme Prediction     

No EC number prediction in MGYG000004687_01628.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.70e-63	3	260	10	289	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	7.21e-18	73	158	1	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
cd16977	VHS_GGA	0.005	18	73	60	118	VHS (Vps27/Hrs/STAM) domain of GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) subfamily. GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprises a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins involved in membrane trafficking between the Trans-Golgi Network (TGN) and endosomes. The VHS domain has a superhelical structure similar to the structure of the ARM (Armadillo) repeats and is present at the N-termini of proteins. GGA proteins have a multidomain structure consisting of an N-terminal VHS domain linked by a short proline-rich linker to a GAT (GGA and TOM) domain, which is followed by a long flexible linker to the C-terminal appendage, GAE (Gamma-Adaptin Ear) domain. The VHS domain of GGA proteins binds to the acidic-cluster dileucine (DxxLL) motif found on the cytoplasmic tails of cargo proteins trafficked between the Trans-Golgi Network and the endosomal system.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP12239.1	3.43e-190	1	260	1	260
QEN11046.1	3.43e-190	1	260	1	260
AWI50249.1	2.94e-166	1	260	1	260
SNV36599.1	8.85e-157	3	260	5	262
AFU19707.1	8.85e-157	3	260	5	262

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P46393	7.27e-104	3	181	5	183	Uncharacterized glycosyltransferase in aroQ 3'region OS=Actinobacillus pleuropneumoniae OX=715 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004687_01628.