CAZyme Information: MGYG000004680_03028

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora
• CAZyme ID: MGYG000004680_03028
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		36301.44	4.6805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004680	3596809	MAG	Germany	Europe

• Gene Location: Start: 6574; End: 7539 Strand: -

Full Sequence      

MIHISQDGTGDFKSIMDALNSLPEDNTSEQVLFIHKGFYEEQITVTVPYVTFQGEEAEST
ILSYGLYAKMVMEDGGKRGTFRTYSSLIDTHDFTARNITFENSAGPGTKVGQALALYADG
DRLVFENCRLLGNQDTLFTGPLPPKEMEVNGFIGPKQNSPRINGRQYYKNCYIEGDIDFI
FGSATAYFEGCTFFSKYTGKEISSYVTAASTPEGQEYGYVMSDCRFESNCPAENAYLGRP
WREYAKTVLINCYMDDHICKQGWHDWNKQEAHEHAFYAEYGSYGPGAAMDMRPDWIVRLK
KEDLNKYTREAVLSGGDHWTP

Enzyme Prediction     

No EC number prediction in MGYG000004680_03028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	314	2.8e-95	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.39e-85	11	315	93	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	8.35e-70	4	308	4	290	Pectinesterase.
PLN02773	PLN02773	6.16e-68	1	307	6	290	pectinesterase
PLN02432	PLN02432	1.36e-60	1	319	12	291	putative pectinesterase
PLN02990	PLN02990	4.73e-58	4	321	263	561	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	2.38e-207	1	321	1	321
ANU50094.1	1.62e-140	4	321	19	348
QQR01004.1	1.62e-140	4	321	19	348
QIX89293.1	4.64e-140	4	321	19	348
QJU20267.1	6.32e-140	4	321	20	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	7.17e-37	4	316	11	305	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.62e-36	4	295	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.28e-35	12	321	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	5.00e-29	11	313	43	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	5.86e-26	4	287	13	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.98e-57	1	313	6	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	6.51e-50	4	321	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FM79	6.30e-46	1	319	81	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q43043	4.18e-45	4	319	61	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q8LPF3	1.73e-44	1	319	60	356	Probable pectinesterase 68 OS=Arabidopsis thaliana OX=3702 GN=PME68 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004680_03028.